DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT33B

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_002270.1 Gene:KRT33B / 3884 HGNCID:6451 Length:404 Species:Homo sapiens


Alignment Length:421 Identity:111/421 - (26%)
Similarity:181/421 - (42%) Gaps:102/421 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPSTHSQTASSPLS-PTRHSRV----------AEKVELQNLNDRLATYIDRVRNLETENSRLTIE 85
            |||.|..|.....: |...|..          :||..:|.||||||:|:::||.||.:|:.    
Human    23 PPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLERDNAE---- 83

  Fly    86 VQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDI-----KRLWEENEELKNKLDK 145
                                         |::..|:|::.:..:     :..::..|||:.|:  
Human    84 -----------------------------LENLIRERSQQQEPLLCPSYQSYFKTIEELQQKI-- 117

  Fly   146 KTKECTTAEGNVRMY------ESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRK 204
               .|:.:| |.|:.      :..|::...||....:.|:.:..|:|              ..|:
Human   118 ---LCSKSE-NARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDIN--------------SLRR 164

  Fly   205 NLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDA----KLK 265
            .|::.||.|.|||..::||:|||....|.|.||:|..|       .::..||:.|.||    .|.
Human   165 ILDELTLCRSDLEAQMESLKEELLSLKQNHEQEVNTLR-------CQLGDRLNVEVDAAPAVDLN 222

  Fly   266 QSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANIN 330
            |.|.|.|.|||..::.||.|::..:..:.:.|.:....:|       |:|:|.:..|..|...:|
Human   223 QVLNETRNQYEALVETNRREVEQWFATQTEELNKQVVSSS-------EQLQSYQAEIIELRRTVN 280

  Fly   331 ELE-QANADLNARIRDLERQLDNDRERHGQE-------IDLLEKELIRLREEMTQQLKEYQDLMD 387
            .|| :..|..|.|. .||..|.....|:..:       |..:|.:|..:|.::.:|.:|||.|:|
Human   281 ALEIELQAQHNLRY-SLENTLTESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLD 344

  Fly   388 IKVSLDLEIAAYDKLLVGEEARLNITPATNT 418
            ::..|:.||..|..||..|:.:|...|...|
Human   345 VRARLECEINTYRSLLESEDCKLPSNPCATT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 101/377 (27%)
Ax_dynein_light <283..377 CDD:287215 23/101 (23%)
LTD 466..572 CDD:279300
KRT33BNP_002270.1 Head 1..56 7/32 (22%)
Filament 55..366 CDD:306535 101/378 (27%)
Coil 1A 57..91 16/66 (24%)
Linker 1 92..102 0/9 (0%)
Coil 1B 103..203 33/126 (26%)
Linker 12 204..219 5/14 (36%)
Coil 2 220..363 44/150 (29%)
Tail 364..404 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.