DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT15

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_011523086.1 Gene:KRT15 / 3866 HGNCID:6421 Length:463 Species:Homo sapiens


Alignment Length:379 Identity:105/379 - (27%)
Similarity:177/379 - (46%) Gaps:81/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            ||:.:||||||||:|:|:||.||..|:.|.:::   .|...::|.                    
Human   105 EKITMQNLNDRLASYLDKVRALEEANADLEVKI---HDWYQKQTP-------------------- 146

  Fly   119 ARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEG--------NVRMYESRANELNNKYNQAN 175
                ...|.|..:.::..|||::|:     ..||.:.        |.|:   .|::...||....
Human   147 ----TSPECDYSQYFKTIEELRDKI-----MATTIDNSRVILEIDNARL---AADDFRLKYENEL 199

  Fly   176 ADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINE 240
            |.|:.:..|:|              ..|:.|::.||:|.|||..|:.|.|||::..:.|.:.:..
Human   200 ALRQGVEADIN--------------GLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEWVPP 250

  Fly   241 SRRIKQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAA 301
            ..:..:...|::.|:::.|.||    .|.:.|.|:|.|||...:.||.::::.:..|.:.|.:..
Human   251 ILQEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEV 315

  Fly   302 ARTSNSTHKSIEELRSTRVRIDALNANINELE---QANADLNARIRDLERQLDNDRERHGQEIDL 363
            |  ||:     |.:::::..|..|...:.|||   |:...:.|   .||..|.....|:..::..
Human   316 A--SNT-----EMIQTSKTEITDLRRTMQELEIELQSQLSMKA---GLENSLAETECRYATQLQQ 370

  Fly   364 -------LEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARL 410
                   ||.:|..||.||..|.:||:.|:|||..|:.|||.|..||.|::|::
Human   371 IQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKM 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 104/376 (28%)
Ax_dynein_light <283..377 CDD:287215 25/103 (24%)
LTD 466..572 CDD:279300
KRT15XP_011523086.1 Filament 104..423 CDD:278467 104/376 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.