DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT13

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_705694.3 Gene:KRT13 / 3860 HGNCID:6415 Length:458 Species:Homo sapiens


Alignment Length:402 Identity:110/402 - (27%)
Similarity:187/402 - (46%) Gaps:68/402 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            ||:.:||||||||:|:::||.||..|:.|.:::   ||...:::.                    
Human   104 EKITMQNLNDRLASYLEKVRALEEANADLEVKI---RDWHLKQSP-------------------- 145

  Fly   119 ARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNE 183
                |..|.|....::..|||::|:...|.|.......:......|::...||....|.|:.:..
Human   146 ----ASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELALRQSVEA 206

  Fly   184 DLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTE 248
            |:|              ..|:.|::.|||:.|||..|:||.|||::..:.|.:|:.|..      
Human   207 DIN--------------GLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFS------ 251

  Fly   249 YSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRL-QEAAARTS--N 306
             :::.|:::.|.||    .|.:.|.|:|.|||...:.||.:.:..:..|...| :|.:..|:  .
Human   252 -NQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHTKSAELNKEVSTNTAMIQ 315

  Fly   307 STHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRL 371
            ::...|.|||.|   :..|...:.......|.|...:.:.|.:.....::....|..:|.:|..|
Human   316 TSKTEITELRRT---LQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSEL 377

  Fly   372 REEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARL--------NITPATNTATVQSFSQSL 428
            |.||..|.:||:.|:|||..|:.|||.|..||.|::|::        :::|.:.:.|..| |.|:
Human   378 RSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTS-SASV 441

  Fly   429 RNSTRATPSRRT 440
            ..::.|: .|||
Human   442 TTTSNAS-GRRT 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 100/361 (28%)
Ax_dynein_light <283..377 CDD:287215 21/96 (22%)
LTD 466..572 CDD:279300
KRT13NP_705694.3 Head 1..103
Filament 103..415 CDD:306535 100/361 (28%)
Coil 1A 104..139 18/37 (49%)
Linker 1 140..158 3/41 (7%)
Coil 1B 159..250 29/104 (28%)
Linker 12 251..273 5/28 (18%)
Coil 2 274..412 42/140 (30%)
Tail 413..458 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..458 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.