DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT12

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_000214.1 Gene:KRT12 / 3859 HGNCID:6414 Length:494 Species:Homo sapiens


Alignment Length:456 Identity:112/456 - (24%)
Similarity:196/456 - (42%) Gaps:116/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQ---TTRDTVTRETTNIKNIFEAELLETRRL 114
            :||..:||||||||:|:|:||.||..|:.|..:::   .||.|.|.:.                 
Human   124 SEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADA----------------- 171

  Fly   115 LDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMY------ESRANELNNKYNQ 173
                      ::.|..:.:...|:|:||:      .:.:.||.::.      ...|.:...||..
Human   172 ----------SQSDYSKYYPLIEDLRNKI------ISASIGNAQLLLQIDNARLAAEDFRMKYEN 220

  Fly   174 ANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEI 238
            ..|.|:.:..|:|              ..|:.|::.||:|.|||..|:||.|||::..:.|..|:
Human   221 ELALRQGVEADIN--------------GLRRVLDELTLTRTDLEMQIESLNEELAYMKKNHEDEL 271

  Fly   239 NESRRIKQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQE 299
             :|.|:..      .|.:|.|.||    .|.:.|.::|||||...:.||.:.::.:.:|...|::
Human   272 -QSFRVGG------PGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRK 329

  Fly   300 AAARTSNSTHKSIEELRSTRVRIDALNANI-----------NELEQANADLNARIRDLERQLDND 353
            ..:..:.....|..|:...|.....|...:           :.|.:|..|..|::..:::.:.| 
Human   330 EISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISN- 393

  Fly   354 RERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGE------EARLNI 412
                      ||.:|:::|.:..:|..::|.|:::|..|:|||..|.:||.||      |..|.:
Human   394 ----------LEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFV 448

  Fly   413 TPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKE 477
            |.:             ::..::|.|.:.|:...|.| .||.|..:..|....|.       ||:|
Human   449 TDS-------------KSQAQSTDSSKDPTKTRKIK-TVVQEMVNGEVVSSQVQ-------EIEE 492

  Fly   478 I 478
            :
Human   493 L 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 97/384 (25%)
Ax_dynein_light <283..377 CDD:287215 16/104 (15%)
LTD 466..572 CDD:279300 3/13 (23%)
KRT12NP_000214.1 Head 1..124 112/456 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Filament 124..436 CDD:278467 94/376 (25%)
Coil 1A 125..160 18/34 (53%)
Linker 1 164..182 4/44 (9%)
Coil 1B 183..274 29/111 (26%)
Linker 12 275..297 7/27 (26%)
Coil 2 298..435 34/147 (23%)
Tail 436..494 17/79 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..468 5/34 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.