DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT6B

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_005546.2 Gene:KRT6B / 3854 HGNCID:6444 Length:564 Species:Homo sapiens


Alignment Length:419 Identity:112/419 - (26%)
Similarity:206/419 - (49%) Gaps:73/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPQPP--PPS-----THSQTASSPLS-----PTRHSRVAEKVELQNLNDRLATYIDRVRNLETEN 79
            ||..|  ||.     |.:|:..:||:     ..:..|..|:.:::.||::.|::||:||.||.:|
Human   124 GPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQN 188

  Fly    80 SRLTIEVQTTRDTVTRE------TTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEE 138
                 :|..|:.|:.:|      ..|::.:||..:...||.||:...:|.|.:.:::.:.:..|:
Human   189 -----KVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVED 248

  Fly   139 LKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETR 203
            ||||.:.:..:.|.||                                          .:|...:
Human   249 LKNKYEDEINKRTAAE------------------------------------------NEFVTLK 271

  Fly   204 KNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAK--LKQ 266
            |:::...:::|:|:....:|.:|::|...::..|:::    .||..|:....||.:.:..  |..
Human   272 KDVDAAYMNKVELQAKADTLTDEINFLRALYDAELSQ----MQTHISDTSVVLSMDNNRNLDLDS 332

  Fly   267 SLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINE 331
            .:.|::|||||..|.:|.|.:|.|:.|.:.||..|.|..:....:.:|:......|..|.:.|:.
Human   333 IIAEVKAQYEEIAQRSRAEAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDH 397

  Fly   332 LEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEI 396
            :::..|:|.|.|.|.|::.:...:....:::.||..|.:.::::.:.|||||:||::|::||:||
Human   398 VKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEI 462

  Fly   397 AAYDKLLVGEEARLN--ITPATNTATVQS 423
            |.|.|||.|||.|||  .....|.:.|||
Human   463 ATYRKLLEGEECRLNGEGVGQVNISVVQS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 95/362 (26%)
Ax_dynein_light <283..377 CDD:287215 22/93 (24%)
LTD 466..572 CDD:279300
KRT6BNP_005546.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Head 2..162 10/37 (27%)
Keratin_2_head 17..159 CDD:318448 9/34 (26%)
Filament 162..475 CDD:306535 95/363 (26%)
Coil 1A 163..198 14/39 (36%)
Linker 1 199..217 4/17 (24%)
Coil 1B 218..309 22/136 (16%)
Linker 12 310..333 6/22 (27%)
Coil 2 334..472 46/137 (34%)
Tail 473..564 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.