DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT3

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_024304743.1 Gene:KRT3 / 3850 HGNCID:6440 Length:716 Species:Homo sapiens


Alignment Length:435 Identity:103/435 - (23%)
Similarity:202/435 - (46%) Gaps:76/435 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGNTSTPR--PPSAGPQPPPPSTHSQTASSPLSPTRHSRVA-----EKVELQNLNDRLATYIDRV 72
            ||:..:|.  .|...|......|.:|:...||:.....::.     |:.:::.||::.|::||:|
Human   240 PGSLGSPGGFGPGGFPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKV 304

  Fly    73 RNLETENSRLTIE---VQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWE 134
            |.||.:|..|..:   :|....:....|.|::.:||..:...|..||:...:|.|.:.::|.:.:
Human   305 RFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMED 369

  Fly   135 ENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQF 199
            ..|:.|.|.:.:..:.|.||                                          .:|
Human   370 LVEDFKKKYEDEINKRTAAE------------------------------------------NEF 392

  Fly   200 EETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAK- 263
            ...:|:::...:::|:|:..:.:|.:|:.|...::..|:::    .|:..|:....||.:.:.. 
Human   393 VTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQ----MQSHISDTSVVLSMDNNRSL 453

  Fly   264 -LKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNA 327
             |...:.|:|||||:..|.::.|.::||:.|:..||..|.|..:....:..|:......|..|.|
Human   454 DLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIELNRMIQRLRA 518

  Fly   328 NINELEQANADLNARIRDLERQLDNDRERHGQ--------EIDLLEKELIRLREEMTQQLKEYQD 384
            .|..:::.||:|...|.        :.|:||:        ::..|:..|.:.::::.:.|::||:
Human   519 EIEGVKKQNANLQTAIA--------EAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQE 575

  Fly   385 LMDIKVSLDLEIAAYDKLLVGEEARLN--ITPATNTATVQSFSQS 427
            ||::|::||:|||.|.|||.|||.|::  ...|.:.:.|.|.:.|
Human   576 LMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 89/367 (24%)
Ax_dynein_light <283..377 CDD:287215 22/101 (22%)
LTD 466..572 CDD:279300
KRT3XP_024304743.1 Keratin_2_head <258..282 CDD:318448 4/23 (17%)
Filament 285..600 CDD:306535 89/368 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.