DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Krt4

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_006242457.1 Gene:Krt4 / 315323 RGDID:1359272 Length:528 Species:Rattus norvegicus


Alignment Length:409 Identity:104/409 - (25%)
Similarity:203/409 - (49%) Gaps:67/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GNTSTPRPPSAGPQPPPPSTHSQTASSPLS-----PTRHSRVAEKVELQNLNDRLATYIDRVRNL 75
            |....|..|:.|.|   ..|.:|:..:||.     ..:..|.||:.:::.||::.|::||:||.|
  Rat   106 GGPGFPVCPAGGIQ---EVTINQSLLTPLQVEIDPEIQKIRTAEREQIKTLNNKFASFIDKVRFL 167

  Fly    76 ETENSRL-----TIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE 135
            |.:|..|     .::.|||    |....|:...||..:...|:.||..:.|:.|.:.::|.:.:.
  Rat   168 EQQNKVLETKWNLLQQQTT----TTSPRNLDPFFETYINALRKNLDTLSNDKGRLQSELKLMQDS 228

  Fly   136 NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFE 200
            .|:.|.|.:::..:.|.||.:                                          |.
  Rat   229 VEDFKTKYEEEINKRTAAEND------------------------------------------FV 251

  Fly   201 ETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLK 265
            ..:|:::...:.:|:||..::||::|::|...::..|:::    .||..|:....||.:.:..|.
  Rat   252 VLKKDVDAAYMIKVELEAKMESLKDEINFMRVLYEAELSQ----MQTHVSDTSVVLSMDNNRNLD 312

  Fly   266 QS--LQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNAN 328
            ..  :.|:||||||..:.::.|::|.|:.|:|:||.:|.:..:|...:..|:......|..:.:.
  Rat   313 LDGIIAEVRAQYEEIARKSKAEVESWYQIKVQQLQMSADQHGDSLKSTKNEISELNRMIQRIRSE 377

  Fly   329 INELEQANADLNARIRDLERQLDND-RERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSL 392
            |..:::.:..|.|.:.|.|::.:.. ::.:.:..| ||..|.:.:|::.:.:::||:||::|::|
  Rat   378 IENIKKQSQTLQASVADAEQRGELALKDAYTKRAD-LETALQKAKEDLARLMRDYQELMNVKLAL 441

  Fly   393 DLEIAAYDKLLVGEEARLN 411
            |:|||.|.|||.|||.|::
  Rat   442 DVEIATYRKLLEGEECRMS 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 92/362 (25%)
Ax_dynein_light <283..377 CDD:287215 21/94 (22%)
LTD 466..572 CDD:279300
Krt4XP_006242457.1 Keratin_2_head 14..142 CDD:292825 9/38 (24%)
Filament 146..458 CDD:278467 92/362 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.