DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Krt75

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001008828.2 Gene:Krt75 / 300247 RGDID:1359576 Length:555 Species:Rattus norvegicus


Alignment Length:435 Identity:111/435 - (25%)
Similarity:208/435 - (47%) Gaps:76/435 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GNTSTPRPPSAGPQPPPPSTHSQTASSPLS----PT-RHSRVAEKVELQNLNDRLATYIDRVRNL 75
            |....|..||...|   ..|.:|:..:||:    || :..|..|:.:::.||::.|::||:||.|
  Rat   100 GGPGFPVCPSGSIQ---EVTVNQSLLTPLNLQIDPTIQRVRKEEREQIKTLNNKFASFIDKVRFL 161

  Fly    76 ETENSRLTIEVQTTRDTVTRET-TNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEEL 139
            |.:|..|..:....::..:|.. .|::..|:|.:.:.||.||....:|.|.:.:::.:.|..|:.
  Rat   162 EQQNKVLETKWNLLQEQGSRTVRQNLEPFFDAYVNDLRRQLDSVTAERGRLDAELRHMQEVVEDF 226

  Fly   140 KNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRK 204
            |                || ||   :|:|.:....|                      :|...:|
  Rat   227 K----------------VR-YE---DEINKRAAAEN----------------------EFVGLKK 249

  Fly   205 NLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAK--LKQS 267
            :::...:::|:||..:.||.::::|...::..|:::    .|.:.|:....||.:.:..  |...
  Rat   250 DVDGAYMNKVELEAKVDSLTDQINFYRMVYEAELSQ----MQNQVSDTSVVLSMDNNRSLDLDSI 310

  Fly   268 LQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINEL 332
            :.|::||||:....:|.|.:|.|:.|.:.||..|.|..:....:.:|:......|..|.:.|:.:
  Rat   311 IAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRSEIDAV 375

  Fly   333 EQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIA 397
            ::..:.|...|.|.|::.:...:....::..||..|.:.:::|.:.|:|||:||::|::||:|||
  Rat   376 KKQCSSLQTAISDTEQRGELALKDARAKLVELEDALQKAKQDMARLLREYQELMNVKLALDVEIA 440

  Fly   398 AYDKLLVGEEARLN---ITP----------------ATNTATVQS 423
            .|.|||.|||.||:   ::|                |..|:||.|
  Rat   441 TYRKLLEGEECRLSGEGVSPVNICEYDPCGPGLSWSAVVTSTVSS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 91/357 (25%)
Ax_dynein_light <283..377 CDD:287215 21/93 (23%)
LTD 466..572 CDD:279300
Krt75NP_001008828.2 Keratin_2_head 16..136 CDD:406589 11/38 (29%)
Filament 139..452 CDD:365827 91/358 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.