DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Krt15

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001004022.1 Gene:Krt15 / 287700 RGDID:1303044 Length:447 Species:Rattus norvegicus


Alignment Length:411 Identity:107/411 - (26%)
Similarity:180/411 - (43%) Gaps:69/411 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            |||.:||||||||:|:|:||.||..|:.|.:::   ||...:::.                    
  Rat    94 EKVTMQNLNDRLASYLDKVRALEEANTELEVKI---RDWYQKQSP-------------------- 135

  Fly   119 ARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNE 183
                |..:.|....::..||:::|:...|.:.:.....:......|::...||....|.|:.:..
  Rat   136 ----ASPDRDYSHYFKTMEEIRDKILAATIDNSRVILEIDNARLAADDFRLKYENELALRQGVEA 196

  Fly   184 DLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTE 248
            |:|              ..|:.|::.||:|.|||..|:.|.|||::..:.|.:|:.|..      
  Rat   197 DIN--------------GLRRVLDELTLARTDLEMQIEQLNEELAYLKKNHEEEMKEFS------ 241

  Fly   249 YSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTH 309
             |::.|:::.|.||    .|.:.|.|:|.|||...:.||.::::.:..|.:.|.:..|..:....
  Rat   242 -SQLAGQVNVEMDAAPGVDLTRMLAEMREQYEAIAEKNRRDVEAWFFSKTEELNKEVASNTEMIQ 305

  Fly   310 KSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREE 374
            .|..|:...|..:..|...:.......|.|...:.::|.:.....::....|..||.:|..||.|
  Rat   306 TSKTEITDLRRTLQGLEIELQSQLSMKAGLENSLAEVECRYATQLQQIQGLITGLETQLSELRCE 370

  Fly   375 MTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRR 439
            |..|.:||..|:|||..|:.||:.|..||.|::|::        |.:.....|||..:       
  Rat   371 MEAQNQEYNMLLDIKTRLEQEISTYRNLLEGQDAKM--------AAIGVREASLRGGS------- 420

  Fly   440 TPSAAVKRKRAVVDESEDHSV 460
              |.........|:||.|..|
  Rat   421 --SGGGSNFHISVEESVDGKV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 96/358 (27%)
Ax_dynein_light <283..377 CDD:287215 19/93 (20%)
LTD 466..572 CDD:279300
Krt15NP_001004022.1 Head. /evidence=ECO:0000255 1..93
Filament 93..405 CDD:278467 96/358 (27%)
Coil 1A. /evidence=ECO:0000255 94..129 20/37 (54%)
Linker 1. /evidence=ECO:0000255 130..148 2/41 (5%)
Coil 1B. /evidence=ECO:0000255 149..240 26/104 (25%)
Linker 12. /evidence=ECO:0000255 241..260 5/25 (20%)
Coil 2. /evidence=ECO:0000255 261..402 39/140 (28%)
Tail. /evidence=ECO:0000255 403..447 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.