DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Krt36

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001008759.1 Gene:Krt36 / 287698 RGDID:1305792 Length:468 Species:Rattus norvegicus


Alignment Length:429 Identity:112/429 - (26%)
Similarity:192/429 - (44%) Gaps:82/429 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDT-VTRETTNIKNIFE-AELLETRRLLD 116
            ||..:|.||||||.|:::||.||.||::|...::...:: :.....:.::.|: ||.|:.:.||.
  Rat    88 EKATMQVLNDRLANYLEKVRQLEQENAQLECRIREWYESQIPYICPDYQSYFKTAEDLQQKILLT 152

  Fly   117 DTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKL 181
            .:...|...:||..:|                              .|::...||....:.|:.:
  Rat   153 KSENARLILQIDNAKL------------------------------AADDFRTKYETELSLRQMV 187

  Fly   182 NEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQ 246
            ..|:|              ..|:.|::.||.:.|||..::||:|||....:.|.:|:|..|    
  Rat   188 EADIN--------------GLRRILDELTLCKADLEAQVESLKEELLCLKRNHEEEVNALR---- 234

  Fly   247 TEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNS 307
               |::..||:.|.||    .|.:.|.::|.|||..::.||.::::.:..:.:.|.:....:|  
  Rat   235 ---SQLGDRLNVEVDAAPPVDLNKILDDMRCQYETLVENNRRDVEAWFNTQTEELNQQVVSSS-- 294

  Fly   308 THKSIEELRSTRVRIDALNANINELE-QANADLNARIRDLERQLDNDRERHGQE-------IDLL 364
                 |:|:..:..|..|...:|.|| :..|..:.| ..||..|.....|:..:       |..:
  Rat   295 -----EQLQCCQTEIIELRRTVNALEIELQAQHSMR-NSLESTLAETEARYSSQLGQMQCLITNV 353

  Fly   365 EKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLR 429
            |.:|..:|.::.:|..|||.|:|:|..|:.|||.|.:||.||:.:|...|. :|...........
  Rat   354 ESQLAEIRCDLERQNHEYQVLLDVKARLESEIATYRRLLEGEDCKLPAHPC-STDCKPPVRVPFV 417

  Fly   430 NSTRATPS-------RRTPSAAVKRK-RAVVDESEDHSV 460
            .||..||:       ..||::.|..: |.:.:|..|..|
  Rat   418 PSTSCTPAVPCTPAGPCTPASQVSTQIRTITEEIRDGRV 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/368 (27%)
Ax_dynein_light <283..377 CDD:287215 20/101 (20%)
LTD 466..572 CDD:279300
Krt36NP_001008759.1 Filament 87..398 CDD:278467 98/368 (27%)
RILP-like 241..381 CDD:304877 38/147 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.