DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and GFAP

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_024306458.1 Gene:GFAP / 2670 HGNCID:4235 Length:540 Species:Homo sapiens


Alignment Length:507 Identity:144/507 - (28%)
Similarity:227/507 - (44%) Gaps:96/507 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSP-TRHSRVAEKVELQNLNDRLATYI 69
            ||.|..|    ..|..|.|     ||.|:....:.:..|:. .:.:|.:|:.|:..||||.|:||
Human    29 RRLGPGT----RLSLARMP-----PPLPTRVDFSLAGALNAGFKETRASERAEMMELNDRFASYI 84

  Fly    70 DRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWE 134
            ::||.||.:|..|..|:...|   .:|.|.:.::::|||.|.|..||....:.||.|::...|.:
Human    85 EKVRFLEQQNKALAAELNQLR---AKEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQ 146

  Fly   135 ENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELE------ 193
            :...::.||..:|.....||.|:..|    .::.....:....||.|.........:|.      
Human   147 DLATVRQKLQDETNLRLEAENNLAAY----RQVREVEGRGRGGRKGLMATHPNTAPKLSPPEQCA 207

  Fly   194 -----------RLRKQFEE-------------TRKNLEQETLSRVDLENTIQSLREELSFKDQIH 234
                       |||...:|             ..:..::.||:|:|||..|:||.||:.|..:||
Human   208 APHCPRRRGKARLRNGEKEPGAPVALYSSPLLPLQEADEATLARLDLERKIESLEEEIRFLRKIH 272

  Fly   235 SQEINE--SRRIKQTEYSEIDGRLSSEYDAK--LKQSLQELRAQYEEQMQINRDEIQSLYEDKIQ 295
            .:|:.|  .:..:|..:.|:|       .||  |..:|:|:|.|||.....|..|.:..|..|..
Human   273 EEEVRELQEQLARQQVHVELD-------VAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFA 330

  Fly   296 RLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQE 360
            .|.:||||.:....::..|....|.::.:|..::..|...|       ..||||:....|||.:|
Human   331 DLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTN-------ESLERQMREQEERHVRE 388

  Fly   361 -------IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNT 418
                   :..||:|...|::||.:.|:|||||:::|::||:|||.|.|||.|||.|:       |
Human   389 AASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRI-------T 446

  Fly   419 ATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAK 470
            ..||:||.......::|                 .:.|:|.|..|..|.:.:
Human   447 IPVQTFSNLQIRGGKST-----------------KDGENHKVTRYLKSLTIR 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 120/395 (30%)
Ax_dynein_light <283..377 CDD:287215 27/100 (27%)
LTD 466..572 CDD:279300 1/5 (20%)
GFAPXP_024306458.1 Filament_head 4..66 CDD:309741 11/45 (24%)
Filament 68..444 CDD:306535 120/396 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.