DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and F10C1.8

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_495132.2 Gene:F10C1.8 / 266725 WormBaseID:WBGene00017327 Length:160 Species:Caenorhabditis elegans


Alignment Length:151 Identity:41/151 - (27%)
Similarity:73/151 - (48%) Gaps:12/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 RKRAVVDESEDHSVADYYVSAS----AKGNVEIKEIDPEGKFVRLFN-KGSEEVAIGGWQLQRLI 506
            |.|.|..|.:.....:....:|    |||||.|.|.||:||::.|.| .||....:..::::|:|
 Worm    13 RTRLVPVEQDHWDSGEVQTRSSFKRHAKGNVSIVECDPQGKYIILENTSGSVAEDVSNFEIRRVI 77

  Fly   507 NEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQ-KWVSADNTRTILLNSEGEA 570
             :...:..::....:.|:.:|.:.::..:....:..|.|:||:|. .|.......|.|.||.|..
 Worm    78 -DGVQAFVFRLPSHLVIQQHGHLKIYGRNAGEINLTPDSIVMESHASWGQGRQAETFLYNSHGIE 141

  Fly   571 VAN---LDRIKRIVSQHTSSS 588
            .|:   :||..:::  |.||:
 Worm   142 KASHILIDRFLQLL--HPSSN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467
Ax_dynein_light <283..377 CDD:287215
LTD 466..572 CDD:279300 31/111 (28%)
F10C1.8NP_495132.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H7818
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.