DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Nefm

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_058725.1 Gene:Nefm / 24588 RGDID:3160 Length:845 Species:Rattus norvegicus


Alignment Length:449 Identity:113/449 - (25%)
Similarity:212/449 - (47%) Gaps:62/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRL 114
            ||..||.:||.||||.|.||::|..||.:|..:..|:...|...... ..:.:.::.|:.|.|..
  Rat    95 SRSNEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIHALRQKQASH-AQLGDAYDQEIRELRAT 158

  Fly   115 LDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRK 179
            |:....::|:.::|...|.|:...||.:.:::.                                
  Rat   159 LEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEA-------------------------------- 191

  Fly   180 KLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRI 244
            :|.:|...|::.|          ||::|:.::.:|:|:..:|||::|::|....|.:|:.:  .:
  Rat   192 RLRDDTEAAIRAL----------RKDIEESSMVKVELDKKVQSLQDEVAFLRSNHEEEVAD--LL 244

  Fly   245 KQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTH 309
            .|.:.|.|...........:..:|:|:|:|.|.....|..:.:..::.:..:|.|||.:...:..
  Rat   245 AQIQASHITVERKDYLKTDISTALKEIRSQLECHSDQNMHQAEEWFKCRYAKLTEAAEQNKEAIR 309

  Fly   310 KSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREE 374
            .:.||:...|.::.:.:..:..:......|..::.|:|.:.::|...:...|..||.||...:.|
  Rat   310 SAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEERHNHDLSSYQDTIQQLENELRGTKWE 374

  Fly   375 MTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQ-SLRNSTRATPSR 438
            |.:.|:|||||:::|::||:|||||.|||.|||.|.:....:.|..:.:..| |:..|::...::
  Rat   375 MARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFSGSITGPLYTHRQPSVTISSKIQKTK 439

  Fly   439 -RTPSAAVKRK--RAVVDES--EDH--------SVADYYVSASA---KGNVEIKEIDPE 481
             ..|...|:.|  ..:::|:  ||.        :|....::|||   |...|.||.:||
  Rat   440 VEAPKLKVQHKFVEEIIEETKVEDEKSEMEDALTVIAEELAASAKEEKEEAEEKEEEPE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 90/354 (25%)
Ax_dynein_light <283..377 CDD:287215 18/93 (19%)
LTD 466..572 CDD:279300 9/19 (47%)
NefmNP_058725.1 Filament_head 10..97 CDD:282575 1/1 (100%)
Filament 98..409 CDD:278467 90/355 (25%)
Coil 1A 103..134 14/30 (47%)
Linker 1 135..147 1/12 (8%)
Coil 1B 148..246 26/141 (18%)
Linker 12 247..263 2/15 (13%)
Coil 2A 264..285 6/20 (30%)
Linker 2 286..289 0/2 (0%)
Coil 2B 290..410 38/119 (32%)
Tail 411..844 20/88 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..782 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.