DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Krt90

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_808385.2 Gene:Krt90 / 239673 MGIID:3045312 Length:538 Species:Mus musculus


Alignment Length:423 Identity:115/423 - (27%)
Similarity:199/423 - (47%) Gaps:86/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPQPPPPSTHSQTASSPLSPTRH---------SRVAEKVELQNLNDRLATYIDRVRNLETENS-- 80
            |..|.....|..|.:..|....|         .|..||.:::.||::.|::||:||.||.:|.  
Mouse   107 GMAPGAGGIHEVTVNQSLLTPLHLEIDPSLQRVRKEEKEQIKTLNNKFASFIDKVRFLEQQNKVL 171

  Fly    81 ----RLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKN 141
                .|..|.:|||       ||::.:|||.:...||.|:....:|:|.|.::|.:.:..|:.||
Mouse   172 ETKWSLLQEHKTTR-------TNLEPMFEAYITNLRRQLECLGGERSRLETELKSMQDVVEDFKN 229

  Fly   142 KLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNL 206
            |.:::....|.||                                          .:|...:|::
Mouse   230 KYEEEIHRRTAAE------------------------------------------NEFVVLKKDV 252

  Fly   207 EQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLK--QSLQ 269
            :...:::|:||..:::|.:|::|.......|:.:    .|.:.||....||.:.:..|.  ..:.
Mouse   253 DAAYMNKVELEAKVEALMDEINFLRAFFEAELAQ----LQAQISETSVVLSMDNNRSLNLDSIIA 313

  Fly   270 ELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALN-------A 327
            |::||||:....:|.|.:|.|:.|.:.||.:|.:..       ::||:|::.|..||       :
Mouse   314 EVKAQYEDIANRSRAEAESWYQTKYEELQRSAGQRG-------DDLRTTKMEISELNRAMQRLRS 371

  Fly   328 NINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSL 392
            .|:.|::..|.|.|.|.|.|::.:...:....::..||..|.:.:::|.:||:|||:||::|::|
Mouse   372 EIDNLKKQCATLQASIADAEQRGELALKDAKNKLAELEDALQKAKQDMARQLREYQELMNVKLAL 436

  Fly   393 DLEIAAYDKLLVGEEARL--NITPATNTATVQS 423
            |:|||.|.|||.|||.||  ....|.|.:.|.|
Mouse   437 DIEIATYRKLLEGEECRLTGEGVGAVNISVVSS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 102/369 (28%)
Ax_dynein_light <283..377 CDD:287215 26/100 (26%)
LTD 466..572 CDD:279300
Krt90NP_808385.2 Keratin_2_head 16..139 CDD:292825 6/31 (19%)
Filament 142..453 CDD:278467 102/370 (28%)
GluZincin 214..>291 CDD:301352 19/122 (16%)
DUF883 366..>426 CDD:295076 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.