DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and DES

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001918.3 Gene:DES / 1674 HGNCID:2770 Length:470 Species:Homo sapiens


Alignment Length:475 Identity:136/475 - (28%)
Similarity:227/475 - (47%) Gaps:81/475 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRRAGTA-------TPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQNLN 62
            ||.:|.|       ..:.|.|.||....||     .......|.:.......:|..||||||.||
Human    57 SRTSGGAGGLGSLRASRLGTTRTPSSYGAG-----ELLDFSLADAVNQEFLTTRTNEKVELQELN 116

  Fly    63 DRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI 127
            ||.|.||::||.||.:|:.|..||...:.   ||.|.:..::|.||.|.||.::.....|||.::
Human   117 DRFANYIEKVRFLEQQNAALAAEVNRLKG---REPTRVAELYEEELRELRRQVEVLTNQRARVDV 178

  Fly   128 DIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKEL 192
            :...|.::.:.||.||.::.:....||.|:..:                                
Human   179 ERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAF-------------------------------- 211

  Fly   193 ERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLS 257
                      |.:::..||:|:|||..|:||.||::|..::|.:||.|.:...|.:..:::..:|
Human   212 ----------RADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMS 266

  Fly   258 SEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRI 322
            .   ..|..:|:::|||||.....|..|.:..|:.|:..|.:||.:.:::..::.:|:...|.:|
Human   267 K---PDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQI 328

  Fly   323 DALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMD 387
            .:....|:.|:..|..|..::|:||.:..::...:...|..||:|:..|::||.:.|:|||||::
Human   329 QSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLN 393

  Fly   388 IKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVK------ 446
            :|::||:|||.|.|||.|||:|:|:       .:|::  |..|....:|.:|......|      
Human   394 VKMALDVEIATYRKLLEGEESRINL-------PIQTY--SALNFRETSPEQRGSEVHTKKTVMIK 449

  Fly   447 ----RKRAVVDES--EDHSV 460
                |...||.|:  :.|.|
Human   450 TIETRDGEVVSEATQQQHEV 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 110/354 (31%)
Ax_dynein_light <283..377 CDD:287215 23/93 (25%)
LTD 466..572 CDD:279300
DESNP_001918.3 head 1..107 12/54 (22%)
Head 2..108 12/55 (22%)
Filament_head 9..106 CDD:309741 11/53 (21%)
Filament 107..415 CDD:306535 110/355 (31%)
rod 108..411 107/350 (31%)
Coil 1A 109..141 19/31 (61%)
Linker 1 142..151 3/11 (27%)
Coil 1B 152..252 34/141 (24%)
Linker 12 253..268 2/17 (12%)
Interaction with NEB. /evidence=ECO:0000269|PubMed:23615443 268..415 50/146 (34%)
Coil 2A 269..287 7/17 (41%)
Linker 2 288..295 2/6 (33%)
Coil 2B 296..412 38/115 (33%)
tail 412..469 15/65 (23%)
Tail 413..470 15/66 (23%)
Interaction with CRYAB. /evidence=ECO:0000269|PubMed:28470624 438..453 1/14 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.