DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt98

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_005155788.1 Gene:krt98 / 100124615 ZFINID:ZDB-GENE-070822-8 Length:391 Species:Danio rerio


Alignment Length:385 Identity:103/385 - (26%)
Similarity:182/385 - (47%) Gaps:82/385 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQ---TTRDTVTRETTNIKNIFEAELLETRRLL 115
            :|..:||||.|||:|:::||:||..|:.|..::.   .:.|.||.:.||    |:..:.:.|...
Zfish    49 KKATMQNLNTRLASYLEKVRSLEKANTELEQKISDWYDSHDDVTFDHTN----FQDTIQDLRNEF 109

  Fly   116 DDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKK 180
            :..::|.|:..:::     :|.:|                       .|::...||....|.|::
Zfish   110 NTRSQDNAKLILEV-----DNAKL-----------------------AADDFKRKYENELAMRRE 146

  Fly   181 LNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIK 245
            :..|..              ..||.|::.:|||.|||..|::|:||.....:.|.:.|       
Zfish   147 IEADTG--------------NLRKILDEFSLSRSDLELQIEALKEEFIVLKKNHKENI------- 190

  Fly   246 QTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSN 306
             |...|..|:::...||    .|.|::.|:|..||...|.||:|::|.||.|:..:|:..     
Zfish   191 -TLTIETGGQVNVSVDAAPSMDLNQAIDEIRQHYETVTQKNREELESWYESKMAPMQQEV----- 249

  Fly   307 STHKSIEELRSTRVRIDALNANINELE---QANADLNARIRDLERQLDNDRERHGQEIDLLEKEL 368
            |.|.  |||:.:|..:..|.:.:..|:   |.:..:.:   :|:.||::...|:|.::..|:..:
Zfish   250 SNHN--EELQDSRTELKDLTSTLQRLQIELQTHQSMKS---NLDGQLEDTEARYGNQLAGLQTTV 309

  Fly   369 IRLREEMTQ-------QLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATV 421
            ..|.::::|       ..:||:.|:|:|..|:.|||.|.:||.||::. |....|.|.||
Zfish   310 SNLEDQLSQFHANIANNKEEYETLLDVKTRLEREIAEYRRLLDGEKSE-NHKLLTKTITV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/371 (26%)
Ax_dynein_light <283..377 CDD:287215 23/96 (24%)
LTD 466..572 CDD:279300
krt98XP_005155788.1 Filament 50..356 CDD:278467 98/369 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.