DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt7

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_002935788.2 Gene:krt7 / 100101751 XenbaseID:XB-GENE-876869 Length:523 Species:Xenopus tropicalis


Alignment Length:414 Identity:109/414 - (26%)
Similarity:209/414 - (50%) Gaps:70/414 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 THSQTASSPLS----PT-RHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVT 94
            |.:|:..:||:    || :|.|..|:.:::.||::.|::||:||.||.:|..|..:.:..::..:
 Frog   111 TINQSLLAPLNLEIDPTIQHVRQEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWELLQNQKS 175

  Fly    95 RETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRM 159
            .:.:|:..:|:|.:...||.||....|:.:.|.:::.:.:..|:.|||.:.:..:.|:||     
 Frog   176 AKASNVGPLFDAYIANLRRQLDGLTGDKGKLEGELRNMQDLVEDFKNKYEDEINKRTSAE----- 235

  Fly   160 YESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLR 224
                                                 .:|...:|:::...:::|:||..:::|.
 Frog   236 -------------------------------------NEFVVLKKDVDAAYMNKVELEAKMEALT 263

  Fly   225 EELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQS--LQELRAQYEEQMQINRDEIQ 287
            :|::|...::..|:.|    .|.:.|:....||.:.:..|...  :.|::||||:....:|...:
 Frog   264 DEINFLRALYEAELRE----LQEQISDTSVVLSMDNNRALDMDSIIAEVKAQYEDIANKSRANAE 324

  Fly   288 SLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDN 352
            ::|::|.|.||..|.|..       ::||:|:..|..||..:..|:.....:.|:...||.|:..
 Frog   325 AVYQNKFQELQATAGRHG-------DDLRTTKTEISELNRAMQRLQAEIESVKAQRAKLEAQIAE 382

  Fly   353 DRERHGQ--------EIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEAR 409
            ..|| |:        ::..||..|.:.:::|.:||:|||:||::|::||:|||.|.|||.|||.|
 Frog   383 AEER-GELALKDARTKLAELEAALQKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEETR 446

  Fly   410 LNITPA-TNTATVQSFSQSLRNST 432
            ::..|. .:.:.|.|.|.|:..|:
 Frog   447 ISEGPGPVSVSVVNSTSSSMGGSS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 94/364 (26%)
Ax_dynein_light <283..377 CDD:287215 26/101 (26%)
LTD 466..572 CDD:279300
krt7XP_002935788.2 Keratin_2_head <106..131 CDD:374433 6/19 (32%)
Filament 134..446 CDD:365827 94/365 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.