DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel25E and CG7878

DIOPT Version :9

Sequence 1:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster


Alignment Length:400 Identity:120/400 - (30%)
Similarity:187/400 - (46%) Gaps:66/400 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATL-----QQLEPSDNN 109
            |::|..|...||..||.:|.:..|..:.|.|::..|::|.|||..|:|..:     |........
  Fly   292 PDMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRG 356

  Fly   110 TCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRIL 174
            ..:|||:..|||||.||..|.:::|  ...:|....:||.........|:.|. .|::.||||:.
  Fly   357 GANVLVLAPTRELALQIEMEVKKYS--FRGMKAVCVYGGGNRNMQISDLERGA-EIIICTPGRLN 418

  Fly   175 ALIRNKKLNLKLLKHFVLDECDKMLE----------QLDMRRDVQEIFRSTPHGKQVMMFSATLS 229
            .||....:::..:.:.||||.|:||:          .||:|.|           :|.:|.|||..
  Fly   419 DLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPD-----------RQTIMTSATWP 472

  Fly   230 KDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLFELLDVLEFNQVVIFVKSV 294
            ..:|.:.:.:|::|::|.|........|.::| .:.|.|::.:|          ||.:..|||::
  Fly   473 PGVRRLAQSYMKNPIQVCVGSLDLAATHSVKQ-I
IKLMEDDMDK----------FNTITSFVKNM 526

  Fly   295 Q-------------RCVALSQLLTEQNFPAIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGR 346
            .             |...||..||...|....||....|.:|.......|....||||||::..|
  Fly   527 SSTDKIIIFCGRKVRADDLSSELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASR 591

  Fly   347 GMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDA------KILNEVQDRFD 405
            |:|||.:..|.|||.|.:.:.|:|||.|.||.|.:|.:|:|.:.|:.|      :||.|.:    
  Fly   592 GLDIEDITHVINYDFPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQEAE---- 652

  Fly   406 VNISELPEEI 415
               .|:|:|:
  Fly   653 ---QEVPDEL 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 63/212 (30%)
SF2_C_DEAD 259..388 CDD:350174 46/141 (33%)
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 62/210 (30%)
DEXDc 298..505 CDD:214692 64/221 (29%)
Helicase_C 514..624 CDD:278689 40/119 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.