DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel25E and Rm62

DIOPT Version :9

Sequence 1:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_524243.2 Gene:Rm62 / 40739 FlyBaseID:FBgn0003261 Length:719 Species:Drosophila melanogaster


Alignment Length:428 Identity:122/428 - (28%)
Similarity:212/428 - (49%) Gaps:37/428 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EDEEQTETTAVENQEAPKKDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQA 75
            |::|.|....|.|   |.:|    :..:|   ..|:::| ||.|.    |::.|:.:|.:..|.|
  Fly   266 EEQEITVRGQVPN---PIQD----FSEVH---LPDYVMK-EIRRQ----GYKAPTAIQAQGWPIA 315

  Fly    76 VLGMDILCQAKSGMGKTAVFVLATL------QQLEPSDNNTCHVLVMCHTRELAFQISKEYERF- 133
            :.|.:.:..||:|.|||..::|..:      |.|:..|...  .||:..|||||.||.:....| 
  Fly   316 MSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPI--ALVLAPTRELAQQIQQVATEFG 378

  Fly   134 -SKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRILALIRNKKLNLKLLKHFVLDECDK 197
             |.|   |:....|||.........|:.|. .||:.||||::..:.....|||...:.||||.|:
  Fly   379 SSSY---VRNTCVFGGAPKGGQMRDLQRGC-EIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADR 439

  Fly   198 MLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQQH 262
            ||: :.....:::|.......:|.:|:|||..|:::.:.:.|:.:.:::.:........|.::|.
  Fly   440 MLD-MGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQV 503

  Fly   263 YVNLKENEKNKKLFELL-DVLEFNQ----VVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEE 322
            .....|..|.:||..|| |:.:.::    ::|||::.:|...|.:.:.........||...:|.|
  Fly   504 VDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSE 568

  Fly   323 RLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITF 387
            |....::|:..:..|||||::..||:|::.:..|.|:|.|::|:.|:||:.|.||..|||.:..|
  Fly   569 RDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAF 633

  Fly   388 VSDEN--DAKILNEVQDRFDVNISELPEEIDLSTYIEG 423
            .:..|  .||.|.:|....:..|:...|.:..::..:|
  Fly   634 FTKNNAKQAKALVDVLREANQEINPALENLARNSRYDG 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 63/215 (29%)
SF2_C_DEAD 259..388 CDD:350174 41/133 (31%)
Rm62NP_524243.2 PTZ00424 280..656 CDD:185609 113/394 (29%)
DEADc 283..488 CDD:238167 64/219 (29%)
HELICc 499..633 CDD:238034 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.