DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel25E and Dbp45A

DIOPT Version :9

Sequence 1:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster


Alignment Length:379 Identity:119/379 - (31%)
Similarity:190/379 - (50%) Gaps:27/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCH 112
            |:|.:::.:...|.:..:.:|.:|||..:.|.|.:..||:|.|||..|.|..|::|  |:....|
  Fly    14 LRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERL--SEEPVSH 76

  Fly   113 -VLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIVVGTPGRIL-A 175
             .||:..|.|||:|||:::....:.| .|:|.|..||.....:.:.|.. .|||||..|||:. .
  Fly    77 FALVLTPTHELAYQISEQFLVAGQAM-GVRVCVVSGGTDQMVESQKLMQ-RPHIVVAMPGRLADH 139

  Fly   176 LIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIR-----PV 235
            |......:...||:.|:||.|:||.. |....:..|.|..|..:|.:.||||:...|:     |:
  Fly   140 LTGCDTFSFDNLKYLVVDEADRMLNG-DFDESLSIIERCLPKTRQNLFFSATMKDFIKESSIFPI 203

  Fly   236 ---CKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLFELL----DVLEFNQVVIFVKS 293
               |.::.||      .|.|  |:..|.|.|:...:.:::..|.|.|    :..|...|:||..:
  Fly   204 ASDCFEWSQD------SDVA--TVETLDQRYLLCADYDRDMVLIEALRKYREENENANVMIFTNT 260

  Fly   294 VQRCVALSQLLTEQNFPAIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFN 358
            .:.|..||..|.......:.:|..|.|:||:....:||..|.|.|:||::..||:||..|.:|.|
  Fly   261 KKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSVELVMN 325

  Fly   359 YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNEVQDRFDVNISELP 412
            :.:|.....|:|||.|..|.|.||::|:......|.::|..:::..:..::|.|
  Fly   326 HMLPRTPKEYIHRVGRTARAGRKGMSISIFRFPRDLELLAAIEEEINTKLTEHP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 68/209 (33%)
SF2_C_DEAD 259..388 CDD:350174 44/132 (33%)
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 119/379 (31%)
DEADc 9..197 CDD:238167 64/187 (34%)
Helicase_C 239..346 CDD:278689 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.