DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel25E and CG9253

DIOPT Version :9

Sequence 1:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610090.1 Gene:CG9253 / 35379 FlyBaseID:FBgn0032919 Length:507 Species:Drosophila melanogaster


Alignment Length:401 Identity:127/401 - (31%)
Similarity:217/401 - (54%) Gaps:24/401 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNDDLLDYEDEEQTETTAVENQEAPKKDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEV 67
            |::..|..||::.:|..|.|.|:...||:.               |...:.:|..:..::.||::
  Fly    38 DSEAALSGEDDKGSEDDAAEEQKLTWKDLG---------------LNEALCQACDELKWKAPSKI 87

  Fly    68 QHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISKEYER 132
            |.|.||.|:.|.|::..|::|.|||..|.|..|..|..:... ...||:..||||||||.:::|.
  Fly    88 QREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQR-YFALVLTPTRELAFQIGEQFEA 151

  Fly   133 FSKYMPTVKVAVFFGGM-AIQKDEETLKSGTPHIVVGTPGRILALIRNKK-LNLKLLKHFVLDEC 195
            ....: .:|..|..||| .:.:..:..|.  |||::.||||::..:.|.| .|||.:|:.|:||.
  Fly   152 LGSGI-GIKCCVVVGGMDMVAQGLQLAKK--PHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEA 213

  Fly   196 DKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQ 260
            |::| .:|...::.:|.:..|..::..:||||::|.::.:.:..::||::|.|.::.: |:..||
  Fly   214 DRIL-NMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQ-TVEQLQ 276

  Fly   261 QHYVNLKENEKNKKLFELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLN 325
            |.|:.:....|:..|..:|:.|..|..:||..:....|..:.:|......||.:|..|:|.:||.
  Fly   277 QSYLFIPVKYKDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLA 341

  Fly   326 RYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSD 390
            ...:||...:.||::|::..||:||..|::|.|:|:|..|..|:|||.|..|.|..|.|||.|| 
  Fly   342 ALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVS- 405

  Fly   391 ENDAKILNEVQ 401
            :.|.::...::
  Fly   406 QYDIELYQRIE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 66/209 (32%)
SF2_C_DEAD 259..388 CDD:350174 46/128 (36%)
CG9253NP_610090.1 SrmB 34..498 CDD:223587 127/401 (32%)
DEADc 63..264 CDD:238167 67/220 (30%)
HELICc 274..403 CDD:238034 45/128 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.