DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hel25E and CG32344

DIOPT Version :9

Sequence 1:NP_723089.1 Gene:Hel25E / 33781 FlyBaseID:FBgn0014189 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster


Alignment Length:364 Identity:102/364 - (28%)
Similarity:180/364 - (49%) Gaps:11/364 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVL---ATLQ 101
            |.||:...|..|:::.|...|::.|:.:|.:.||..:.|.|::..||:|.||||.|::   ..||
  Fly    38 SGGFQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQ 102

  Fly   102 QLEPSDNNTCHVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFFGGMAIQKDEETLKSGTPHIV 166
            :.||:..  ...|::..|||||.|..|..:...::| .:|..:..||.::......:.: .|.::
  Fly   103 RREPTKG--ARALILSPTRELAVQTYKFIKELGRFM-ELKSILVLGGDSMDSQFSAIHT-CPDVI 163

  Fly   167 VGTPGRILALIRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSATLSKD 231
            |.||||.|.|.....|.|..:::.|.||.|::.| :.....:.|.....|..:|.:||||||.|.
  Fly   164 VATPGRFLHLCVEMDLKLNSIEYVVFDEADRLFE-MGFGEQLNETLHRLPSSRQTVMFSATLPKL 227

  Fly   232 IRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLFELLD--VLEFNQVVIFVKSV 294
            :....:..:.||:.:.:|.|:||. ..|...::..:.:::...|..||.  :...:|.|:|..:.
  Fly   228 LVEFARAGLNDPVLIRLDVESKLP-DALALKFLYCRPDDRYTALVVLLKYVIPVQSQTVVFAGTQ 291

  Fly   295 QRCVALSQLLTEQNFPAIGIHRGMTQEERLNRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNY 359
            .....:|.:|||.......::..:....|.....:|.:.:..:|:.|::..||:||..::.|.|.
  Fly   292 HHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNL 356

  Fly   360 DMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILN 398
            ..|.....::|||.|..|.|..|.|.:.||.::.|.:|:
  Fly   357 HFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hel25ENP_723089.1 DEADc_DDX39 40..248 CDD:350708 64/210 (30%)
SF2_C_DEAD 259..388 CDD:350174 30/130 (23%)
CG32344NP_612028.4 DEADc 41..243 CDD:238167 62/206 (30%)
DEXDc 54..243 CDD:214692 59/193 (31%)
HELICc 263..384 CDD:238034 29/120 (24%)
DBP10CT 666..721 CDD:285373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.