DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tomb and AT5G25790

DIOPT Version :9

Sequence 1:NP_608936.1 Gene:tomb / 33779 FlyBaseID:FBgn0031715 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001332765.1 Gene:AT5G25790 / 832648 AraportID:AT5G25790 Length:504 Species:Arabidopsis thaliana


Alignment Length:74 Identity:29/74 - (39%)
Similarity:43/74 - (58%) Gaps:12/74 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KGCCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNTEVRE----LVDPNSVA------KNSSAVK 80
            |||.|::|.|:|.||:|||:..:|::.|||..|:|.|..|    |:..:.|:      ..::||.
plant   180 KGCHCRKSGCLKKYCECYQANILCSENCRCQDCKNFEGSEERKALLHGSQVSDTYIQQMTNAAVN 244

  Fly    81 RQKAAAMSA 89
            |  |..|||
plant   245 R--AIDMSA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tombNP_608936.1 TCR 28..62 CDD:281618 16/33 (48%)
AT5G25790NP_001332765.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12446
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.