DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tomb and Lin54

DIOPT Version :9

Sequence 1:NP_608936.1 Gene:tomb / 33779 FlyBaseID:FBgn0031715 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_006250719.1 Gene:Lin54 / 305171 RGDID:1311361 Length:767 Species:Rattus norvegicus


Alignment Length:240 Identity:58/240 - (24%)
Similarity:92/240 - (38%) Gaps:72/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSPKKRSVDKADGKKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNTEVREL 66
            |...|..:.|  ||:|:...... |||.||||.|:||||:||::..:|:..|:|:||:|.|    
  Rat   594 PEAFKPKIGK--GKEGESDRRHS-KGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFE---- 651

  Fly    67 VDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGIDVQGKALQVAASTLALPGKALMTPPKYTLVA 131
                       ....:|.....|.||....:.         |.||.|                  
  Rat   652 -----------ESPERKTLMHLADAAEVRVQQ---------QTAAKT------------------ 678

  Fly   132 GKPPMASSHINPIPISRPIATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPVNAALL 196
                ..||.|:.: ::||     |||   .......:|...:              .:.|..|..
  Rat   679 ----KLSSQISDL-LTRP-----TPA---LNSGGGKLPFTFV--------------TKEVAEATC 716

  Fly   197 ECMLIQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSKD 241
            .|:|.||.:|::.|.::....:::||||.|...:::....:...|
  Rat   717 NCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSD 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tombNP_608936.1 TCR 28..62 CDD:281618 18/33 (55%)
Lin54XP_006250719.1 TCR 540..>563 CDD:281618
TCR 614..649 CDD:281618 19/35 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1171
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12446
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.