DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tomb and tesmin

DIOPT Version :9

Sequence 1:NP_608936.1 Gene:tomb / 33779 FlyBaseID:FBgn0031715 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_017209794.1 Gene:tesmin / 100330665 ZFINID:ZDB-GENE-131121-605 Length:350 Species:Danio rerio


Alignment Length:244 Identity:58/244 - (23%)
Similarity:81/244 - (33%) Gaps:108/244 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRSVDKADG---------KKGKGQGAGGVKGCCCKRSQCIKNYCDCYQSMAICTKFCRCVGCRNT 61
            |..:|:..|         |:|..:|. ..|||.||||.|:||||:||::..:||..|:|||||| 
Zfish   201 KACLDRNPGAFRPKIGSRKQGNVKGC-HTKGCNCKRSGCLKNYCECYEAKIMCTSTCKCVGCRN- 263

  Fly    62 EVRELVDPNSVAKNSSAVKRQKAAAMSAKAAAAAAKAGIDVQGKALQVAASTLALPGKALMTPPK 126
                 .|.....|.||...|.                  |:.                       
Zfish   264 -----YDEGCDMKKSSEQDRH------------------DIY----------------------- 282

  Fly   127 YTLVAGKPPMASSHINPIPISRPIATAATPARAVKQPAEPPMPVNLIIPVRHDDRRDRNLFVQPV 191
                                        .|.|.         ||::|       .||       |
Zfish   283 ----------------------------FPTRC---------PVSVI-------TRD-------V 296

  Fly   192 NAALLECMLIQATEAEQLGLNELQVCQLVLEEFMRGYKNILEKICEYSK 240
            ..|...|:|.||.||::.|.......:::||||.:....|:..|.:.|:
Zfish   297 VEATCGCLLAQAEEAQKDGHIAAHAERMILEEFGQCLTQIVRSIFKSSR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tombNP_608936.1 TCR 28..62 CDD:281618 21/33 (64%)
tesminXP_017209794.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12446
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.