DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq6 and BNA4

DIOPT Version :9

Sequence 1:NP_608934.1 Gene:Coq6 / 33777 FlyBaseID:FBgn0031713 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_009454.1 Gene:BNA4 / 852179 SGDID:S000000194 Length:460 Species:Saccharomyces cerevisiae


Alignment Length:411 Identity:96/411 - (23%)
Similarity:149/411 - (36%) Gaps:134/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IIIGGGGLVGTTLAAALAK---NSTLADKKVLLLEGAPEFRGFNP---TGPYQNRVS---AINHN 106
            :.|.|.||||...|.|.:|   |.||.|           ||. :|   |...:|..|   ||:..
Yeast     5 VAIIGAGLVGCLAALAFSKEGYNVTLYD-----------FRQ-DPRLDTTKNKNLKSINLAISAR 57

  Fly   107 SIELFKSI--DAWKHIESARYKPVKQMQVWE--SNTDALIQFQHDNFASDVACIIENDLILDAV- 166
            .|:..|||  ||.:||..... |:|...:.:  ...::.:...|....:.:...:.|:.:||.: 
Yeast    58 GIDALKSIDPDACEHILQDMI-PMKGRMIHDLKGRQESQLYGLHGEAINSINRSVLNNSLLDELE 121

  Fly   167 ---------YALAKESPNVEILNKARIQCVRLPRDSNSNHSELQLEDGRNFSCDLLIGADGANSV 222
                     :.|.|    :|..:..:|....:..|..:.|:|         ..|.:||.|||.|.
Yeast   122 KSTTELKFGHKLVK----IEWTDDKQICHFAIGEDLKTPHTE---------KYDFVIGCDGAYSA 173

  Fly   223 VRKEM--------NVDVFSLNYDRMGLVATLELGEDACDNSVAWQRFLPN--GPVALLPLTDRLS 277
            .|.:|        :.:..:|.|..:.:..|              :.|.||  |..|:.|  |.|.
Yeast   174 TRSQMQRKVEMDFSQEYMNLRYIELYIPPT--------------EEFKPNYGGNFAIAP--DHLH 222

  Fly   278 SLVWSTTNEQAKMLQALPPTEFVDALNEAFCRQYPRVELADKAVQALNSLFGHNGS--------- 333
              :|             |..:|:            .:.||:......::.||....         
Yeast   223 --IW-------------PRHKFM------------LIALANSDGSFTSTFFGSKDQISDLITSKS 260

  Fly   334 ---QHQVQYPPRVCGVLD-----KSRATFPLGFLHASSYVC----------NGAALVGDAAHRVH 380
               :..::..|.:..::|     |...|:|     ..|.||          ..|.|:|||||.:.
Yeast   261 RVREFLIENFPDIINIMDLDDAVKRFITYP-----KESLVCVNCKPYDVPGGKAILLGDAAHAMV 320

  Fly   381 PLAGQGVNLGFSDVRYLVESL 401
            |..|||:|.||.|||.|:..|
Yeast   321 PFYGQGMNCGFEDVRILMALL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq6NP_608934.1 Ubi-OHases 58..476 CDD:273913 93/404 (23%)
COQ6 58..471 CDD:273914 93/404 (23%)
BNA4NP_009454.1 UbiH 1..378 CDD:223727 96/411 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.