DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq6 and LYC

DIOPT Version :9

Sequence 1:NP_608934.1 Gene:Coq6 / 33777 FlyBaseID:FBgn0031713 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_187634.1 Gene:LYC / 820185 AraportID:AT3G10230 Length:501 Species:Arabidopsis thaliana


Alignment Length:197 Identity:44/197 - (22%)
Similarity:77/197 - (39%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LGV----LRIQGALASAGQARLLSVRLLASKSTTDMTTNRGESTQSTSTEHFDIIIGGGGLVGTT 62
            |||    ::|..::.| |.|.||.:.....|...|......::::|   :..|:.|.|||..|  
plant    36 LGVKKRAIKIVSSVVS-GSAALLDLVPETKKENLDFELPLYDTSKS---QVVDLAIVGGGPAG-- 94

  Fly    63 LAAALAKNSTLADKKVLLLEGAPEFRGFNPTGPYQNRVSAINHNSIELFKSID-AW--------- 117
              .|:|:..:.|...|..::.:|:....|..|.:.:...|     ::|...:| .|         
plant    95 --LAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEA-----MDLLDCLDTTWSGAVVYVDE 152

  Fly   118 --KHIESARY-----KPVKQMQVWESNTDALIQFQ--------HDNFASDVACI----IENDLIL 163
              |...|..|     |.:|...:.:..|:. ::|.        |:...|.|.|.    |:..::|
plant   153 GVKKDLSRPYGRVNRKQLKSKMLQKCITNG-VKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVL 216

  Fly   164 DA 165
            ||
plant   217 DA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq6NP_608934.1 Ubi-OHases 58..476 CDD:273913 27/137 (20%)
COQ6 58..471 CDD:273914 27/137 (20%)
LYCNP_187634.1 PLN02463 55..501 CDD:178082 37/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43876
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.