DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq6 and cn

DIOPT Version :9

Sequence 1:NP_608934.1 Gene:Coq6 / 33777 FlyBaseID:FBgn0031713 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_523651.4 Gene:cn / 35724 FlyBaseID:FBgn0000337 Length:465 Species:Drosophila melanogaster


Alignment Length:400 Identity:87/400 - (21%)
Similarity:156/400 - (39%) Gaps:93/400 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RGESTQSTSTEHFD----IIIGGGGLVGTTLAAALAKNSTLAD--------KKVLLLEGAPEFRG 89
            |.|.|::...|...    :.:.|.||||:..|...|:.....|        ::.|:::|    |.
  Fly    13 RQEPTEAARDERHGRRRRVAVIGAGLVGSLAALNFARMGNHVDLYEYREDIRQALVVQG----RS 73

  Fly    90 FNPTGPYQNR--VSAINHNSIELFKSIDAWKHIESARYKPVKQMQVWESNTDALIQFQHDNFASD 152
            .|.....:.|  ::|:......|..:|            |::...:            || ...:
  Fly    74 INLALSQRGRKALAAVGLEQEVLATAI------------PMRGRML------------HD-VRGN 113

  Fly   153 VACIIENDLILDAVYALAKESPNVEILNKARIQCVRLP--------RDSNSNHSELQLEDGRN-- 207
            .:.::.:.:....:|::.:...|..:||    .|.:||        :.:::|..|..:| .||  
  Fly   114 SSVVLYDPINNQCLYSVGRRQLNEVLLN----ACDKLPNIRCHFEHKLTSANLREGSME-FRNPA 173

  Fly   208 -----FSCDLLIGADGANSVVRKEMNVDVFSLNYDRMGLVATLELGE-DACDNSVAWQRFLPNGP 266
                 ...||::|.|||.|.||:. ||.:...||.:    ..:|.|. :.|..|.:....:|...
  Fly   174 KEAVAAHADLIVGCDGAFSSVRQN-NVRLPGFNYSQ----EYIETGYLELCIPSKSGDFQMPANY 233

  Fly   267 VALLPLTDRLSSLVWSTTNEQAKMLQALP-PTE-FVDALNEAFCRQYPRVELADKAVQALNSLFG 329
            :.:.|   |.:.::.:..|:.......|. |.| |....|:....::.::...|    ||..:  
  Fly   234 LHIWP---RNTFMMIALPNQDKSFTVTLSMPFEIFAGIQNQNDLLEFFKLNFRD----ALPLI-- 289

  Fly   330 HNGSQHQVQYPPRVCGVLD--KSRATFPLGFLHASSYVCNGAALVGDAAHRVHPLAGQGVNLGFS 392
              |.|..::         |  |:|..|.:.......:..:.|.::|||||.:.|..|||:|.|..
  Fly   290 --GEQQLIK---------DFFKTRPQFLVSIKCRPYHYADKALILGDAAHAMVPYYGQGMNAGME 343

  Fly   393 DVRYLVESLA 402
            ||..|.:.||
  Fly   344 DVTLLTDILA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq6NP_608934.1 Ubi-OHases 58..476 CDD:273913 80/374 (21%)
COQ6 58..471 CDD:273914 80/374 (21%)
cnNP_523651.4 UbiH 31..411 CDD:223727 82/381 (22%)
NADB_Rossmann 31..353 CDD:304358 81/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.