DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq6 and Sqle

DIOPT Version :9

Sequence 1:NP_608934.1 Gene:Coq6 / 33777 FlyBaseID:FBgn0031713 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_033296.1 Gene:Sqle / 20775 MGIID:109296 Length:572 Species:Mus musculus


Alignment Length:494 Identity:106/494 - (21%)
Similarity:176/494 - (35%) Gaps:148/494 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TTNRGESTQSTSTEHF---DIIIGGGGLVGTTLAAALAKNSTLADKKVLLLE---GAPE------ 86
            ||..|.:| |.||...   ::||.|.|::|:.|||.|:::.    :||.::|   ..|:      
Mouse   105 TTLTGAAT-SVSTSFVTDPEVIIVGSGVLGSALAAVLSRDG----RKVTVIERDLKEPDRIVGEL 164

  Fly    87 -----FRGFNPTGPYQNRVSAINHNSIELFKSIDAWKHIESARYKPVKQMQV----WESN-TDAL 141
                 :|.....| ..:.|..:|.:.|..:...|         |:...::|:    .|:| ..:.
Mouse   165 LQPGGYRVLQELG-LGDTVEGLNAHHIHGYIVHD---------YESRSEVQIPYPLSETNQVQSG 219

  Fly   142 IQFQHDNFASDVACIIENDLILDAVYALAKESPNVEILNKARIQCVRLPRDS---NSNHSELQLE 203
            |.|.|..|             :.::...|...|||:.:....:|.  |..|.   ...:.:.:..
Mouse   220 IAFHHGRF-------------IMSLRKAAMAEPNVKFIEGVVLQL--LEEDDAVIGVQYKDKETG 269

  Fly   204 DGRNFSCDLLIGADGANSVVRKEMNVDVFSLNYDRMGLVATLELGEDACDNSVAWQRFLPNGPVA 268
            |.:.....|.:.|||..|..||.:.....|::...:|.     |.:||       .:|.||  .|
Mouse   270 DTKELHAPLTVVADGLFSKFRKSLISSKVSVSSHFVGF-----LMKDA-------PQFKPN--FA 320

  Fly   269 LLPLTDRLSSLVWSTTNEQAKMLQALPPTEFVDALNEAFCRQ-YPRV--ELADKAVQALNSLFGH 330
            .|.|.:....|::..::.:.::|..: ..|....|.|....| ||::  .|.:..::|     ..
Mouse   321 ELVLVNPSPVLIYQISSSETRVLVDI-RGELPRNLREYMAEQIYPQLPEHLKESFLEA-----SQ 379

  Fly   331 NGSQHQVQYPPRVCGVLDKSRATFPLGFLHASSYVCNGAALVGDAAHRVHPLAGQGVNLGFSDVR 395
            ||...                 |.|..||..||....|..::|||.:..|||.|.|:.:...|::
Mouse   380 NGRLR-----------------TMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMTVALKDIK 427

  Fly   396 ----------------------------------YLVESLAAGAYAGFK-LGDKQHLI------- 418
                                              ::|..||...|..|. ..|..|.:       
Mouse   428 LWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDDSLHQLRKACFLY 492

  Fly   419 -KYERKCLAKNVPIM--LGVHGL----H----TLYATQF 446
             |...:|:...|.::  |..|.|    |    .:|||.|
Mouse   493 FKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYF 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq6NP_608934.1 Ubi-OHases 58..476 CDD:273913 95/467 (20%)
COQ6 58..471 CDD:273914 95/467 (20%)
SqleNP_033296.1 Interaction with MARCHF6. /evidence=ECO:0000250|UniProtKB:Q14534 1..98
Required for degradation in response to high membrane cholesterol levels. /evidence=ECO:0000250|UniProtKB:Q14534 61..72
Sufficient for enzyme activity. /evidence=ECO:0000250|UniProtKB:Q14534 116..572 100/482 (21%)
UbiH 123..497 CDD:223727 89/439 (20%)
NADB_Rossmann 124..>174 CDD:304358 14/53 (26%)
NADB_Rossmann 275..546 CDD:304358 64/294 (22%)
Hydrophobic, mediates interaction with membranes. /evidence=ECO:0000250|UniProtKB:Q14534 514..572 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.