DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6907 and T26E4.7

DIOPT Version :9

Sequence 1:NP_001285628.1 Gene:CG6907 / 33775 FlyBaseID:FBgn0031711 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_506937.3 Gene:T26E4.7 / 188933 WormBaseID:WBGene00012049 Length:360 Species:Caenorhabditis elegans


Alignment Length:219 Identity:45/219 - (20%)
Similarity:75/219 - (34%) Gaps:81/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDRFM----THAKVLAKY---------------------FLAEGV-------ISKQEI----FLG 80
            :|:|.    |.||||..|                     ||.|||       ....||    :|.
 Worm    82 KDKFFRRHCTVAKVLPSYDAVLFLDADIGVVNPKRKIEEFLEEGVDVTFVNRFYNWEISAGFYLA 146

  Fly    81 SLDDIPAEMLR-------RLPRPL--TDQESMEQSEVQAL-GDAGAENGL-RIAW----RYNDLP 130
            .......::|.       :||...  ||..::.....:.| .||.||:.: :.|:    .|.|| 
 Worm   147 RNTQYAVDLLNGFANYEFKLPFSFHGTDNGALHMYLAEHLFPDASAESNICKKAYSESKSYRDL- 210

  Fly   131 LVNSEHATAK----IGHHF---NLMEQMDSMMLYNVKTT----------------LWDDSPKHLD 172
              .:..|..|    :|..|   .:|:::..:.::..|.|                :|...   ||
 Worm   211 --FTFEACIKSLFGVGTRFGKVRIMKKVVYLFIFCFKNTQFRGTGWARDGWLTSMMWHPD---LD 270

  Fly   173 IVIDEEFSKSSSPTTPSLEQQPVE 196
            .:| ..:..:....||::..:||:
 Worm   271 FMI-HGWKTNQLRKTPNMTMRPVQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6907NP_001285628.1 PAXNEB 3..436 CDD:283315 45/219 (21%)
T26E4.7NP_506937.3 DUF273 58..291 CDD:281328 43/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973442at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.