DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6907 and LOC107987285

DIOPT Version :9

Sequence 1:NP_001285628.1 Gene:CG6907 / 33775 FlyBaseID:FBgn0031711 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_016883688.1 Gene:LOC107987285 / 107987285 -ID:- Length:322 Species:Homo sapiens


Alignment Length:153 Identity:30/153 - (19%)
Similarity:53/153 - (34%) Gaps:57/153 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GHHFNLMEQMDSMMLYNVKTTLWDDSPKHLDIVIDEEFSKSSSPTTPSLEQQPVEDAPPIPGTET 206
            |..:..:.|.|.|.:.:|                        :|:.||.:.|.:. :||.|    
Human   103 GEQWGSLRQADPMAVTSV------------------------TPSPPSAKNQDLY-SPPCP---- 138

  Fly   207 APQEKMPAQEEENSANNNNNNNNNSSSVTSSTKTGSQDSP---LQVFHNPRYKGLLNDIQ--QLL 266
                  |.:               :|.|.::..:||:..|   |.:|.....:...:|::  |..
Human   139 ------PCR---------------ASLVQAAAWSGSEGLPGWGLMLFTALHGRPGEDDLECTQAH 182

  Fly   267 RNESFVAGTKNNLCRVCLTSLGS 289
            |.|..  .|:|:|.|....||.:
Human   183 RREDL--ATRNSLERTAARSLSA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6907NP_001285628.1 PAXNEB 3..436 CDD:283315 30/153 (20%)
LOC107987285XP_016883688.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973442at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.