DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7382 and Timm21

DIOPT Version :10

Sequence 1:NP_608929.1 Gene:CG7382 / 33772 FlyBaseID:FBgn0031708 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_011245396.1 Gene:Timm21 / 67105 MGIID:1920595 Length:249 Species:Mus musculus


Alignment Length:77 Identity:29/77 - (37%)
Similarity:47/77 - (61%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SLQRSQ-DNTQVSTDVRPIGEKIKENTKTASYTAIIIAGLGVTCVMFFAIFRELFSSESPNNIYA 111
            |::|:| :.|.||     :.:|::|..:..||..:::.|:|:|..:.:|||:|||.|.|||.||.
Mouse    82 SIRRNQREETGVS-----MSQKVREAGRDVSYLIVVLFGVGLTGGLLYAIFKELFFSSSPNIIYG 141

  Fly   112 DALRRVVEDPRV 123
            .||.:....|.|
Mouse   142 KALGKCRTHPEV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7382NP_608929.1 TIM21 68..209 CDD:311963 23/56 (41%)
Timm21XP_011245396.1 Coa1 98..>167 CDD:451344 23/56 (41%)

Return to query results.
Submit another query.