DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and mgaa

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_005158676.1 Gene:mgaa / 569620 ZFINID:ZDB-GENE-030603-1 Length:2838 Species:Danio rerio


Alignment Length:288 Identity:102/288 - (35%)
Similarity:147/288 - (51%) Gaps:44/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 QHHHNNNNNNNNNNVAHKSRNSGGAVAQTASAESQLNTSSTSSQGRCSTPPQSPGTEDSEERLTP 165
            |...:::.|:..|.:|....|..|        :|.:.|:....|...||...:..|..||     
Zfish    38 QLQSSDSGNDKANLMAISEANKMG--------KSSIGTTVAGIQPTSSTFADTNSTTPSE----- 89

  Fly   166 EPVQKAPKIVGSCNCDDLKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQI 230
                   .:.....|   :.:...|:...:|:.||...||||:||.||||||..|...||    :
Zfish    90 -------NLPADARC---RGITVTLDNNNMWNEFHRCKTEMILTKQGRRMFPYCRFRLSG----M 140

  Fly   231 QPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEK 295
            :|...|.:.|||.|.|:.||:::  ...|...|||:| ..:||:.||:||.|.....:..:||.:
Zfish   141 EPFQNYVLAMDIKPADNCRYKWS--GKGWEPNGKAEP-HISRLFVHPESPASGLHWMQYPVSFYR 202

  Fly   296 VKLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSN--PKELQDLDHKTYV---FPETVFT 355
            :||.|. :|:.|.|:|:|||||.|:||:        ||::  .|::..||....|   |.:|.|.
Zfish   203 LKLCNT-LDQEGHIILHSMHRYLPQIHI--------IPADKVSKDILILDRPNVVTLSFAQTEFF 258

  Fly   356 AVTAYQNQLITKLKIDSNPFAKGFRDSS 383
            |||||||..||:||||.||||||||:.:
Zfish   259 AVTAYQNLCITQLKIDYNPFAKGFREDA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 87/204 (43%)
mgaaXP_005158676.1 T-box 102..284 CDD:279278 86/197 (44%)
DUF4801 1321..1366 CDD:292677
NTR2 <2131..2271 CDD:292097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.