DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx22

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_005157203.1 Gene:tbx22 / 556143 ZFINID:ZDB-GENE-090626-2 Length:444 Species:Danio rerio


Alignment Length:252 Identity:114/252 - (45%)
Similarity:157/252 - (62%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EPVQKAPKIVGSCNCDDLKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQI 230
            :.::|:.|.......:.::.|:..|:..:||.||:::||||||||.||||||::||.    :..:
Zfish    48 QDLRKSAKERKPAGAEAVRKVRVDLQGSDLWKRFYEIGTEMIITKVGRRMFPSIRVK----VHNL 108

  Fly   231 QPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPA--PPARLYAHPDSPFSCEALRKQVISF 293
            .|..:|::.|||:|||||:|||.||.|.|::||..|.:  || .||.|||||.|.|...:|||||
Zfish   109 DPLQQYSIAMDIMPMDSKKYRYVYHSSQWVIAGNTDHSCIPP-HLYVHPDSPCSGENWMRQVISF 172

  Fly   294 EKVKLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVT 358
            ::|||||||:|..|.|:|.|||:|:||||::.....:.:......|......|:.||||.||.||
Zfish   173 DRVKLTNNELDDRGHIILKSMHKYRPRIHVILHCPPECLSKRLLSLPADGVFTFSFPETQFTTVT 237

  Fly   359 AYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQLRSPLRLFPDPLMQ 415
            |||||.|||||||.||||||||:.:...      ::.:|......||...|....|:
Zfish   238 AYQNQQITKLKIDRNPFAKGFRERNGAV------LDGILESYSWHSPFNGFKSLAME 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 107/200 (54%)
tbx22XP_005157203.1 TBOX 67..260 CDD:238106 106/197 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.