DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and Mga

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_006234859.1 Gene:Mga / 499874 RGDID:1561597 Length:3093 Species:Rattus norvegicus


Alignment Length:300 Identity:109/300 - (36%)
Similarity:159/300 - (53%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 DSEERLTPE--PVQKAPKIVGSCNCDDLKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVR 220
            |:...|:.|  |.:...||....:| .:..:...|:...:|:.||:..||||:||.||||||..|
  Rat    46 DARALLSRESSPGKSKEKICLPADC-TVGKITVTLDNNSMWNEFHNRSTEMILTKQGRRMFPYCR 109

  Fly   221 VSFSGPLRQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEA 285
            ...:|    :....:|.::|||.|:||  :||.::...|..:|||:|....|::.||:||.:...
  Rat   110 YWITG----LDSNLKYILVMDISPVDS--HRYKWNGRWWEPSGKAEPHILGRVFIHPESPSTGHY 168

  Fly   286 LRKQVISFEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFP 350
            ...|.:||.|:|||||.:|:.|.|:|:|||||.||:|||.......:    .:|......|:.||
  Rat   169 WMHQPVSFYKLKLTNNTLDQEGHIILHSMHRYLPRLHLVPAEKATEV----IQLNGPGVHTFTFP 229

  Fly   351 ETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQ----LRSP---LRL 408
            :|.|.|||||||..||:||||.|||||||||....:...||..:....:|:    ..||   :||
  Rat   230 QTEFFAVTAYQNIQITQLKIDYNPFAKGFRDDGLSSKPQRDGKQRNSSDQEGNSVSSSPGHRVRL 294

  Fly   409 FP-----------DPLMQQFAAQGDPSSMALFEKARQHLQ 437
            ..           ||::     :|..:|....|||..:::
  Rat   295 TEGEGSEIHSGDFDPVL-----RGHETSSLGLEKAPNNVK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 88/198 (44%)
MgaXP_006234859.1 T-box_MGA-like 75..260 CDD:410321 86/194 (44%)
DUF4801 1040..1081 CDD:406462
Herpes_BLLF1 <1519..1828 CDD:282904
Atrophin-1 1692..>2024 CDD:397323
bHLHzip_MGA 2454..2518 CDD:381481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.