DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx-43

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001040883.1 Gene:tbx-43 / 4363053 WormBaseID:WBGene00044798 Length:305 Species:Caenorhabditis elegans


Alignment Length:337 Identity:89/337 - (26%)
Similarity:144/337 - (42%) Gaps:66/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 VQCH--LETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSK 248
            :|||  |..|.||..|.....||||||.||.:||.:..:|.|....:    .|.:.:.:.|:..:
 Worm     1 MQCHVALMEKSLWREFDSQCNEMIITKIGRNLFPILEFAFKGLCEHL----NYKIGVTMEPISYQ 61

  Fly   249 RYRYAYHRSAWLVAGKADPAPPARLYAHPDSPF---SCEALRKQVISFEKVKLTNNE--MDKNGQ 308
            :.::        .||:.:..........|:..|   |...|.::.:..||:||||::  :.|:.|
 Worm    62 KLKF--------TAGRWESLDIQEEMVQPNEVFLMKSGRELLQRGLKLEKLKLTNSKDALQKSDQ 118

  Fly   309 IV-LNSMHRYQPRIHLVRLS----HGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKL 368
            :: :.||.:|.|.:::..:|    |.|.             ..:.||||.|.||||||::|:.:|
 Worm   119 MIRVQSMRQYMPVLNIYEISPVGAHNQI-------------GKFQFPETKFIAVTAYQSELVKQL 170

  Fly   369 KIDSNPFAKGFRDS--SRLTDFDRDPMEALLLEQQLRSPLRLFPDPL---MQQFAAQGDPSSMAL 428
            |:..|.||:|||:|  |..|...:.|:..........|.|.:..:.|   .::....|....:.|
 Worm   171 KVQKNKFAQGFRESIKSNATSSTKRPLSTTSSNSSPDSTLSMSSENLGHTTKKGRGGGQEIGVLL 235

  Fly   429 FEKARQHLQMFGGNSPYAQLMMPQMYQAAAAAAGPPPPPPGLGAFHMFQQQWPQLTA-------- 485
               ..|:.|.|...|.::|...|. :|.:.|...|.|.         :|..:.|..|        
 Worm   236 ---TSQNYQSFDQFSNFSQAFPPN-FQPSYAQHYPIPD---------YQPNYAQFGAENFWSLNP 287

  Fly   486 ---GFLASANQQ 494
               .|.|:.|.|
 Worm   288 APYDFTAAGNFQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 64/211 (30%)
tbx-43NP_001040883.1 T-box 5..183 CDD:279278 59/202 (29%)
Ashwin <170..>221 CDD:291969 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.