DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and Tbx19

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001381159.1 Gene:Tbx19 / 304935 RGDID:1310145 Length:448 Species:Rattus norvegicus


Alignment Length:516 Identity:143/516 - (27%)
Similarity:215/516 - (41%) Gaps:142/516 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 AESQLNTSSTSSQGRCSTPPQSPGTEDSEERLTPEPVQKAPKIVGSCNCDDLKPVQCHLETKELW 196
            |.|:|.|.. |.:|..|.......:|....|...:|.:|..:|:              ||...||
  Rat     2 AMSELATQK-SGEGTVSRLLNVVESELQAGREKGDPTEKQLQII--------------LEDAPLW 51

  Fly   197 DRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLV 261
            .||.::..|||:||.||||||.:::|.:|    :.|...|::|:|.:|.||.|::|.  ...|:.
  Rat    52 QRFKEVTNEMIVTKNGRRMFPVLKISVTG----LDPNAMYSLLLDFVPTDSHRWKYV--NGEWVP 110

  Fly   262 AGKADPAPPARLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLVRL 326
            |||.:.:..:.:|.|||||.......|..|||.||||| |::...|||:|||:|:|:|::|:||:
  Rat   111 AGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLT-NKLSGGGQIMLNSLHKYEPQVHIVRV 174

  Fly   327 SHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRD 391
            .....:..|..           ||||.|.|||||||:.||.|||..|||||.|.|:.........
  Rat   175 GGAHRMVMNCS-----------FPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLKEI 228

  Fly   392 PMEALLLEQ--------------------------QLRSPLRL---------------------- 408
            | ||:...|                          |..:||.|                      
  Rat   229 P-EAVSESQHVTYSHLGGWILSNPDGMCTTGSANYQYATPLPLPAPHTRHGCEHYAGLRGHRQAP 292

  Fly   409 FPDPLMQQFAAQGDPSSMALFEKARQHLQMFGG--------NSPYAQLMMPQMYQAAAAAAGP-- 463
            :|...|.    :....|:.|.|.:..:||:|.|        ::|:..::      :....:||  
  Rat   293 YPSAYMH----RNHSPSVNLIESSSNNLQVFSGPESWTSLPSAPHGGIL------SVPHTSGPIN 347

  Fly   464 --PPPPPGLGAFHMFQQQWPQLTAGFLASANQQAAAAQAAAQAQAQAQAAAAAMAANRTPPPPPT 526
              |.|.|.|         |.....|          ....|:.::..|.|:...:..:      ||
  Rat   348 PGPSPYPCL---------WTISNGG----------GGPVASGSEVHASASGTFLLGS------PT 387

  Fly   527 ASTPSS-------TSS-----GSPS-PDMRPRQYQRFSPYQLPGGQGPPSSAAGSPPAVNA 574
            .::|||       ||:     |.|| ..:....:...:.:.|||..||..:...||.::::
  Rat   388 VTSPSSLLPTQATTSAGVEVLGEPSLTSIAVSTWTAVASHPLPGWGGPGGAGRHSPSSLDS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 85/198 (43%)
Tbx19NP_001381159.1 T-box_TBX19-like 36..218 CDD:410327 87/213 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.