DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx16l

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_017211524.1 Gene:tbx16l / 30254 ZFINID:ZDB-GENE-980526-171 Length:492 Species:Danio rerio


Alignment Length:448 Identity:137/448 - (30%)
Similarity:205/448 - (45%) Gaps:110/448 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKR 249
            ||...|:.:||||:|..:||||:|||:||||||:.:|:.:|    :.|..:|.|:||::|.|:  
Zfish    48 PVHVSLQDRELWDKFSSIGTEMLITKSGRRMFPSCKVTVTG----LNPKVKYVVIMDMVPFDN-- 106

  Fly   250 YRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSM 314
            ::|.:::..|.|.|.:||..|.|.:.|||||...:...:..|||.|:|||||.::.||.:||:||
Zfish   107 HKYKWNKDCWEVNGSSDPHLPNRFFIHPDSPAPGQKWMQYPISFHKLKLTNNTLNSNGLVVLHSM 171

  Fly   315 HRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGF 379
            |:||||:|:|: |.....|.||..     :..:.|||..|.||||||||.|||||||:|||||||
Zfish   172 HKYQPRLHIVQ-SPDPCTPHNPGA-----YLRFTFPEAAFIAVTAYQNQEITKLKIDNNPFAKGF 230

  Fly   380 RD------------SSRLTDFDRDPMEALLLEQ-----------------------------QLR 403
            ||            :..:.|.||.....|...:                             |..
Zfish   231 RDNGLNRKRFRDKGTQEMQDTDRQVKLDLTANECGIISTAGMSQMVEDVDVSVSSSVDCRDTQNS 295

  Fly   404 SPLRLFPDPLMQQFAAQGDPSSM---------ALFEKARQHL------------------QMFGG 441
            |.:.|  :|.:..|.   :|||.         .|...:.:|.                  |:..|
Zfish   296 SSVSL--NPFISAFT---NPSSAGGAAAHQTHTLLSLSNRHFSSPRESNLNSVCAALPVSQLSTG 355

  Fly   442 NSPYAQLMMPQMYQAAAAAAGPPPPPPGLGAFHMFQQQWPQLTAGFLASANQQAAAAQAAAQAQA 506
            ::.:::|...:.:..:.......||.|.|.. |..:.:.|         ...:.:..|.:..|..
Zfish   356 HTSFSRLNPQETHHNSRPKIQLQPPHPSLQC-HDLELRLP---------LPPKLSRVQLSESALR 410

  Fly   507 QAQAAAAAMAANRTPPPPPT---------ASTPSSTSSGSPSPDMRPRQYQRFSPYQL 555
            ..:.:..:..||   |.|.|         |||||.....:|.   :|.|:.|.|..::
Zfish   411 NLEMSPLSDCAN---PRPLTNILNRSCFRASTPSGKLLPNPP---QPEQFLRGSEREI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 97/210 (46%)
tbx16lXP_017211524.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574493
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.