DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and MGA

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_005254300.1 Gene:MGA / 23269 HGNCID:14010 Length:3115 Species:Homo sapiens


Alignment Length:225 Identity:93/225 - (41%)
Similarity:130/225 - (57%) Gaps:11/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PVQKAPKIVGSCNCDDLKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQ 231
            ||:...||....:| .:..:...|:...:|:.|:...||||:||.||||||..|...:|    :.
Human    57 PVKSKGKICLPADC-TVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITG----LD 116

  Fly   232 PADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEKV 296
            ...:|.::|||.|:|:  :||.::...|..:|||:|....|::.||:||.:......|.:||.|:
Human   117 SNLKYILVMDISPVDN--HRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKL 179

  Fly   297 KLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQ 361
            |||||.:|:.|.|:|:|||||.||:|||.......:    .:|......|:.||:|.|.||||||
Human   180 KLTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEV----IQLNGPGVHTFTFPQTEFFAVTAYQ 240

  Fly   362 NQLITKLKIDSNPFAKGFRDSSRLTDFDRD 391
            |..||:||||.|||||||||........||
Human   241 NIQITQLKIDYNPFAKGFRDDGLNNKPQRD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 86/198 (43%)
MGAXP_005254300.1 TBOX 74..264 CDD:238106 86/199 (43%)
DUF4801 1041..1087 CDD:292677
HLH 2475..2525 CDD:278439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141543
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.