DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and T

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_033335.1 Gene:T / 20997 MGIID:98472 Length:436 Species:Mus musculus


Alignment Length:468 Identity:145/468 - (30%)
Similarity:198/468 - (42%) Gaps:126/468 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SPGTEDSEERL----------TPEPVQKAPKIVGSCNCDDL-KPVQCHLETKELWDRFHDLGTEM 206
            |||||.:.:.|          ....:|     .||...|.. :.::..||..|||.||.:|..||
Mouse     3 SPGTESAGKSLQYRVDHLLSAVESELQ-----AGSEKGDPTERELRVGLEESELWLRFKELTNEM 62

  Fly   207 IITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPA 271
            |:||.||||||.::|:.||    :.|...|:.|:|.:..|:.|::|.  ...|:..||.:|..|:
Mouse    63 IVTKNGRRMFPVLKVNVSG----LDPNAMYSFLLDFVTADNHRWKYV--NGEWVPGGKPEPQAPS 121

  Fly   272 RLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSNP 336
            .:|.|||||.......|..:||.||||| |:::..|||:|||:|:|:||||:||:...|.:.:  
Mouse   122 CVYIHPDSPNFGAHWMKAPVSFSKVKLT-NKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMIT-- 183

  Fly   337 KELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQ 401
                     ::.||||.|.|||||||:.||.|||..|||||.|.|:....| .:|.||.      
Mouse   184 ---------SHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERND-HKDVMEE------ 232

  Fly   402 LRSPLRLFPDPLMQQFAAQGD---PSSMALFEKARQHLQMFGGN--------------------- 442
                    |....|...:|..   |.:..|...|..|.| |||:                     
Mouse   233 --------PGDCQQPGYSQWGWLVPGAGTLCPPASSHPQ-FGGSLSLPSTHGCERYPALRNHRSS 288

  Fly   443 ---SPYAQLMMPQMYQAAAAAA-------------GPP------------PPPPGLGAFHMFQQQ 479
               ||||.......|...::|.             |.|            .||.|       ..|
Mouse   289 PYPSPYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNASPPTG-------SSQ 346

  Fly   480 WPQL---TAGFLASANQQAAAAQAAAQAQAQAQAAAAAMAANRTPPPPPTASTPSSTSSGSPS-- 539
            :|.|   :.|.:...:|.|..:....     ||....:.|  ...|...|.|..:|:|||||.  
Mouse   347 YPSLWSVSNGTITPGSQTAGVSNGLG-----AQFFRGSPA--HYTPLTHTVSAATSSSSGSPMYE 404

  Fly   540 -----PDMRPRQY 547
                 .|:...||
Mouse   405 GAATVTDISDSQY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 88/198 (44%)
TNP_033335.1 T-box_TBXT 41..219 CDD:410328 87/195 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831479
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.