DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx-42

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_500749.1 Gene:tbx-42 / 190421 WormBaseID:WBGene00022000 Length:308 Species:Caenorhabditis elegans


Alignment Length:256 Identity:58/256 - (22%)
Similarity:111/256 - (43%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LETKELW-DRFHDLGTEMII-TKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRY 252
            :..:||| :|:.::  |||. :|....:||.::...||    ::...||.:::.:..||:.||..
 Worm    11 MSNEELWKERYPNM--EMISNSKRITPIFPEIKFKISG----LEENSRYVLVLSLEKMDNIRYGI 69

  Fly   253 AYHRSAWLVAGKADPAP--PARLYAHPDSPFSCEALRKQVISFEKVKLTNNE--MDKNGQIVLNS 313
            ..::. |..:....|.|  ..:.:.||:.....:.|..:.:.|..|::|.:|  .:|.....:::
 Worm    70 NENKE-WAPSSARKPKPHHNMKFFFHPEGTKLGKELMAETVEFTSVRITTSEKLSEKENVFYVHT 133

  Fly   314 MHRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETV--FTAVTAYQNQLITKLKIDSNPFA 376
            ||:|.|.:.:..|:.|: |.||            :|...:  |..|:.||...:.:.|.|.|..:
 Worm   134 MHKYVPVLTIRNLTTGE-IASN------------IFKMEIAQFFPVSIYQQASMGRWKSDLNKHS 185

  Fly   377 K-GFRDSSRLTDFDRDPMEALLLEQQLRSPLRLFPDPLMQQFAAQGDPSSMALFEKARQHL 436
            . |.|....:.....|....|..::..:.|::  .|.:        |.|.:.|..|..|:|
 Worm   186 TFGNRSEGGIKRKTSDAAGQLPSKRSSKKPVK--KDVV--------DNSEVTLEVKTSQYL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 48/202 (24%)
tbx-42NP_500749.1 T-box 9..190 CDD:279278 47/198 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.