DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and mls-1

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_498640.1 Gene:mls-1 / 186741 WormBaseID:WBGene00003376 Length:252 Species:Caenorhabditis elegans


Alignment Length:219 Identity:96/219 - (43%)
Similarity:140/219 - (63%) Gaps:19/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LTPEPVQKAPKIVGSCNCDDLKPVQCHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPL 227
            |..:||:|..:|:...||   |.::..|::..||.|||:||||||:||:|||||||:.|..:|  
 Worm    11 LARKPVEKRKQIITKDNC---KFIRVFLQSSNLWRRFHNLGTEMIVTKSGRRMFPTLSVIIAG-- 70

  Fly   228 RQIQPADRYAVLMDIIPMDSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVIS 292
              :.|...|.|::|:..::.||:||::|:|.|:..|..:...|:|::.|.|||.......:..:|
 Worm    71 --LDPVKSYVVMVDLECIEMKRFRYSFHQSKWISTGPGESELPSRMFVHTDSPARGAHWMRAPVS 133

  Fly   293 FEKVKLTNNEMDKNGQIVLNSMHRYQPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETVFTAV 357
            |:|:|||||::|.||.|::||||:|:||:|::.....|.            ..|:.|.||.|.||
 Worm   134 FDKMKLTNNQLDNNGHIIVNSMHKYRPRVHIIEQDDSQK------------RHTFSFEETEFIAV 186

  Fly   358 TAYQNQLITKLKIDSNPFAKGFRD 381
            |||||..||.|||:|||||||||:
 Worm   187 TAYQNHRITSLKIESNPFAKGFRE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 88/197 (45%)
mls-1NP_498640.1 TBOX 31..212 CDD:238106 88/196 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.