DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx-9

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_499286.2 Gene:tbx-9 / 176449 WormBaseID:WBGene00006546 Length:292 Species:Caenorhabditis elegans


Alignment Length:367 Identity:101/367 - (27%)
Similarity:144/367 - (39%) Gaps:109/367 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LKPVQCHLETKE--LWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPM 245
            :..|:..:|..:  ||..||....|||:||.||::||.:.....|    :.....||:::.:.|:
 Worm     1 MSKVKVSIEGSQETLWKIFHAEVNEMIVTKNGRKLFPKLEYIVEG----LDENKLYAIMLQLQPV 61

  Fly   246 DSKRYRYAYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRK------QVISFEKVKLTN-NEM 303
            ...|::::  ...|...|||:....|:...|.|      .:||      ..|.|::||::| :|.
 Worm    62 GESRFKFS--GGKWQETGKAEKQVDAKKMWHAD------GVRKGSDWMWSSICFDRVKISNYSES 118

  Fly   304 DKNGQIVLNSMHRYQPRIHLVRLSHGQS---IPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLI 365
            :....|.|||||:|.|.:.:.. |..:|   :|.:..::.    .|..||.|.|.||||||||.|
 Worm   119 NNASMIYLNSMHKYIPVLTIYE-SPSESPFCVPQSSNQIV----ATAKFPHTEFIAVTAYQNQKI 178

  Fly   366 TKLKIDSNPFAKGFRDSSRLTDFDRDPMEALLLEQQLRSPLRLFPDPLMQQFAAQGDPSSMALFE 430
            |.|||..|.|||||||.:              |.::.|||             :..|.|:     
 Worm   179 TDLKIKHNSFAKGFRDGN--------------LSRKRRSP-------------SYSDGSN----- 211

  Fly   431 KARQHLQMFGGNSPYAQLMMPQMYQAAAAAAGPPPPPPGLGAF-HMFQQQWP-QLTAGFLASANQ 493
                      ..||..:...|   ...|.....||..|.|..| ||..:..| |....|      
 Worm   212 ----------SQSPSPKSRSP---PEVAPLQSMPPINPFLFYFPHMLSENLPVQFPFAF------ 257

  Fly   494 QAAAAQAAAQAQAQAQAAAAAMAANRTPPPPPTASTPSSTSS 535
                                       |...|..|||||:||
 Worm   258 ---------------------------PFLSPLPSTPSSSSS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 72/210 (34%)
tbx-9NP_499286.2 TBOX 3..198 CDD:238106 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.