DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mid and tbx3b

DIOPT Version :9

Sequence 1:NP_001260096.1 Gene:mid / 33770 FlyBaseID:FBgn0261963 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_002662050.2 Gene:tbx3b / 100334188 ZFINID:ZDB-GENE-060531-144 Length:594 Species:Danio rerio


Alignment Length:260 Identity:121/260 - (46%)
Similarity:153/260 - (58%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 AVAQTASAESQLNTSSTSS--QGRCSTPPQSPGTEDSEERLTPEPVQKAPKIVGSCNCDDLKPVQ 187
            |.|..:|....|..|:..:  .||...|.|:|  ||       |||                   
Zfish    37 ANALQSSIRLALKESAAPALLSGRTRDPVQTP--ED-------EPV------------------- 73

  Fly   188 CHLETKELWDRFHDLGTEMIITKTGRRMFPTVRVSFSGPLRQIQPADRYAVLMDIIPMDSKRYRY 252
            .|||..|||.:||.:||||:|||:||||||..:|..||..|:.    ||.:||||:..|.  |||
Zfish    74 VHLEGNELWGQFHKVGTEMVITKSGRRMFPAFKVRCSGFDRKA----RYILLMDIVASDD--YRY 132

  Fly   253 AYHRSAWLVAGKADPAPPARLYAHPDSPFSCEALRKQVISFEKVKLTNNEMDKNGQIVLNSMHRY 317
            .:|...|:|||||||..|.|:|.|||||.:.|....:.::|.|:|||||..||:|..:|||||:|
Zfish   133 KFHNCRWMVAGKADPEMPKRMYIHPDSPSTGEQWMSKAVTFHKLKLTNNISDKHGFTILNSMHKY 197

  Fly   318 QPRIHLVRLSHGQSIPSNPKELQDLDHKTYVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDS 382
            |||.|:||.:....:|.:       ..||||||||.|.|||||||:.||:||||:||||||||::
Zfish   198 QPRFHIVRANDVLKLPYS-------TFKTYVFPETEFIAVTAYQNEKITQLKIDNNPFAKGFRET 255

  Fly   383  382
            Zfish   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
midNP_001260096.1 TBOX 185..384 CDD:238106 106/198 (54%)
tbx3bXP_002662050.2 TBOX 74..256 CDD:238106 106/195 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.