DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and mgaa

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:XP_005158676.1 Gene:mgaa / 569620 ZFINID:ZDB-GENE-030603-1 Length:2838 Species:Danio rerio


Alignment Length:279 Identity:101/279 - (36%)
Similarity:146/279 - (52%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SSNSGNSNTNSKSSSQ---RGRSAAAVGAAATPSPPPPPPSQSPEELERLSPEES-PAQQPTPKI 265
            ||:|||...|..:.|:   .|:|:.....|..     .|.|.:..:....:|.|: ||       
Zfish    41 SSDSGNDKANLMAISEANKMGKSSIGTTVAGI-----QPTSSTFADTNSTTPSENLPA------- 93

  Fly   266 VGSCNCDDLTPVQCHLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVL 330
              ...|..:|..   |:...:|::||...||||:||.||||||..|...||    ::|...|.:.
Zfish    94 --DARCRGITVT---LDNNNMWNEFHRCKTEMILTKQGRRMFPYCRFRLSG----MEPFQNYVLA 149

  Fly   331 LDVVPLDSRRYRYAYHRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMD 395
            :|:.|.|:.||:::  ...|...|||: |..||::.||:.|.|.....:..|||.::||.|. :|
Zfish   150 MDIKPADNCRYKWS--GKGWEPNGKAE-PHISRLFVHPESPASGLHWMQYPVSFYRLKLCNT-LD 210

  Fly   396 KSGQVVLNSMHRYQPRIHLVRLSHGQSIPGS--PKELQDMDHK---TFVFPETVFTAVTAYQNQL 455
            :.|.::|:|||||.|:||:        ||..  .|::..:|..   |..|.:|.|.|||||||..
Zfish   211 QEGHIILHSMHRYLPQIHI--------IPADKVSKDILILDRPNVVTLSFAQTEFFAVTAYQNLC 267

  Fly   456 ITKLKIDSNPFAKGFRDSS 474
            ||:||||.||||||||:.:
Zfish   268 ITQLKIDYNPFAKGFREDA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 83/204 (41%)
mgaaXP_005158676.1 T-box 102..284 CDD:279278 82/200 (41%)
DUF4801 1321..1366 CDD:292677
NTR2 <2131..2271 CDD:292097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.