DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx-43

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001040883.1 Gene:tbx-43 / 4363053 WormBaseID:WBGene00044798 Length:305 Species:Caenorhabditis elegans


Alignment Length:313 Identity:84/313 - (26%)
Similarity:136/313 - (43%) Gaps:61/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VQCH--LETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSR 339
            :|||  |..|.||.:|.....||||||.||.:||.:..:|.|....:    .|.:.:.:.|:..:
 Worm     1 MQCHVALMEKSLWREFDSQCNEMIITKIGRNLFPILEFAFKGLCEHL----NYKIGVTMEPISYQ 61

  Fly   340 RYRYAYHRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNE--MDKSGQVV- 401
            :.::...|...|.. :.:...|:.::...    |...|.::.:..||:||||::  :.||.|:: 
 Worm    62 KLKFTAGRWESLDI-QEEMVQPNEVFLMK----SGRELLQRGLKLEKLKLTNSKDALQKSDQMIR 121

  Fly   402 LNSMHRYQPRIHLVRLS----HGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKID 462
            :.||.:|.|.:::..:|    |.|.             ..|.||||.|.||||||::|:.:||:.
 Worm   122 VQSMRQYMPVLNIYEISPVGAHNQI-------------GKFQFPETKFIAVTAYQSELVKQLKVQ 173

  Fly   463 SNPFAKGFRDS--SRLSDFDRDPMDAFFFDQHMRTAPLRFFPDPLMSQLTPQEADAASMALLEKA 525
            .|.||:|||:|  |..:...:.|:.         |......||..:|..:.......     :|.
 Worm   174 KNKFAQGFRESIKSNATSSTKRPLS---------TTSSNSSPDSTLSMSSENLGHTT-----KKG 224

  Fly   526 R------------QHLQMFGRSPYTEMLLPHLYQRSAAP--PPPPPAPHLSAF 564
            |            |:.|.|.:........|..:|.|.|.  |.|...|:.:.|
 Worm   225 RGGGQEIGVLLTSQNYQSFDQFSNFSQAFPPNFQPSYAQHYPIPDYQPNYAQF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 65/208 (31%)
tbx-43NP_001040883.1 T-box 5..183 CDD:279278 60/199 (30%)
Ashwin <170..>221 CDD:291969 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.