DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbxt.2

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001001247.1 Gene:tbxt.2 / 407951 XenbaseID:XB-GENE-5981736 Length:434 Species:Xenopus tropicalis


Alignment Length:410 Identity:132/410 - (32%)
Similarity:190/410 - (46%) Gaps:85/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 VQCHLETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRY 341
            ::.:||..:||.:|.||..|||:||:||||||.:::|.:|    :.|...|:.|:|.|..|:.|:
 Frog    42 LKVNLEDTDLWIRFKELTNEMIVTKNGRRMFPVLKISVTG----LDPNAMYSFLMDFVTADNNRW 102

  Fly   342 RYAYHRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMH 406
            :|.  ...|:..||.:|..||.:|.|||.|.......|..|||.||||| |:|:..||::|||:|
 Frog   103 KYV--NGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLT-NKMNGEGQIMLNSLH 164

  Fly   407 RYQPRIHLVRLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFR 471
            :|:||||:||:       |.|::: ...|.   ||||.|.|||||||:.||.|||..|||||.|.
 Frog   165 KYEPRIHIVRV-------GGPQKM-ITSHS---FPETQFIAVTAYQNEEITALKIKHNPFAKAFL 218

  Fly   472 DSSRLSDFDRDPMDAFFFDQHMRTAPLRFFPDPLMSQLTPQEADAASMALLEKARQHLQMFG--- 533
            |:...|| .:|.:|.....|....:.|.       :.|.|......|      :..|...||   
 Frog   219 DAKERSD-HKDFIDDAENGQQSGYSQLG-------NWLIPGTGSLCS------SSNHHSQFGAPL 269

  Fly   534 ------------------RSPYTEMLLPHLYQRSAAPPPPPPAPHLSAFQLGMWQ--QQWP---- 574
                              .|||..   |:.::.::    ||.....|:..|.::|  ..||    
 Frog   270 SIPSSHGCERYTTLRNHRSSPYPS---PYTHRNNS----PPSYTENSSACLPVFQSNDHWPGLQM 327

  Fly   575 QLTAGFLASANQQAALALAAAGANRTPPPSM-----AVAPPAPATPTSSCGSASPDLRARPQLNH 634
            |...|.|:..:..      .:.:|....||:     :...|.|.|.:.:.|..|..||:...|  
 Frog   328 QTHTGMLSINHTN------GSPSNSCQYPSLWSVSNSTIAPLPQTGSVANGLGSQYLRSSTSL-- 384

  Fly   635 YPQRFSPYQ--VPQHQASPP 652
                ::||.  ||......|
 Frog   385 ----YAPYNQIVPSPTMGSP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 90/197 (46%)
tbxt.2NP_001001247.1 T-box 44..219 CDD:366363 89/192 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201455at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.