DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx-7

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001368540.1 Gene:tbx-7 / 260030 WormBaseID:WBGene00006544 Length:335 Species:Caenorhabditis elegans


Alignment Length:268 Identity:103/268 - (38%)
Similarity:142/268 - (52%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 LETKELWDKFHELGTEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAY 345
            |..:.||..|.|.||||||||.||||||.|::..||    :.....|.::::::.:|  :.||.:
 Worm    68 LVNRNLWSTFLECGTEMIITKKGRRMFPLVKLKLSG----LDKNSNYTIIMEMISVD--KLRYKF 126

  Fly   346 HRSSWLVAGKADPPPPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQP 410
            ...:|:|||..:..|....:.||..|.|.|......|.|:..||:||..:..|.:||||||||.|
 Worm   127 WNGNWIVAGVGEHHPLPTCFVHPQSPRSGEWWMTDGVDFKMAKLSNNPFNNDGHIVLNSMHRYNP 191

  Fly   411 RIHLVRL-SHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSS 474
            |.|:||. |.||.|..|        .|||.|.||.|.|||||||.::||.|||:||||||||:. 
 Worm   192 RFHIVRADSSGQPILAS--------LKTFSFKETEFIAVTAYQNDVVTKCKIDNNPFAKGFRNI- 247

  Fly   475 RLSDFDRDPMDAFFFDQHMRTAPLRFFPDPLMSQLTPQEADAASMALLEKARQHLQMFGRSPYTE 539
                   |.:.....:|.:.|.|.....:|.:.: |..|.:|...:..:..:..||:.  |.:.|
 Worm   248 -------DTVRKRKMNQIISTPPASEDEEPEVKR-TKSEIEAVMFSDPKVPQMSLQLI--SQWQE 302

  Fly   540 MLLPHLYQ 547
            .||..:.|
 Worm   303 ALLSTIVQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 88/194 (45%)
tbx-7NP_001368540.1 T-box 66..245 CDD:395727 86/190 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.