DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and Tbx6

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_035668.2 Gene:Tbx6 / 21389 MGIID:102539 Length:436 Species:Mus musculus


Alignment Length:377 Identity:142/377 - (37%)
Similarity:185/377 - (49%) Gaps:93/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 AAATPSPPPPPPSQSPEELERLSPEESPAQQPTPKIVGSCNCDDLTPVQCHLETKELWDKFHELG 294
            |||.|.|..|         ..|.||.:|   |.|:.:.|     |..|...||.:|||.:|..:|
Mouse    61 AAAAPLPLLP---------SALGPETAP---PPPEALHS-----LPGVSLSLENQELWKEFSAVG 108

  Fly   295 TEMIITKSGRRMFPTVRVSFSGPLRQIQPADRYAVLLDVVPLDSRRYRYAYHRSSWLVAGKADPP 359
            |||||||:||||||..|||.:|    :.|..||..||||||:|..|||  :....|..:|||:|.
Mouse   109 TEMIITKAGRRMFPACRVSVTG----LDPEARYLFLLDVVPVDGARYR--WQGQHWEPSGKAEPR 167

  Fly   360 PPSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNEMDKSGQVVLNSMHRYQPRIHLVRLS-----H 419
            .|.|:|.|||.|.:.....:|.|||.:|||||:.:|..|.::|:|||:|||||||||.:     |
Mouse   168 LPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRATQLCSQH 232

  Fly   420 GQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLSDFDRDPM 484
            ...:            .:|.||||.|.:||||||..||:|||.:||||||||::.|....:||..
Mouse   233 WGGV------------ASFRFPETTFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDAR 285

  Fly   485 DAFFFDQHMRTAPLRFFPDPLMSQL----------------------------TPQEADAASM-- 519
                ..:.:|.      |:|:.::.                            |||||.:||.  
Mouse   286 ----VKRKLRG------PEPVATEACGSGDTPGGPCDSTLGGDIRDSDPEQAPTPQEAASASAPP 340

  Fly   520 ---ALLEKARQHLQMFGRSPYTEMLLPHLYQR----SAAPPPPPPAPHLSAF 564
               ...|....|...|..:|      .||..|    :.||.|..|||:.:||
Mouse   341 CGGPSAEAYLLHPAAFHGAP------SHLPARTPSFAEAPDPGRPAPYSAAF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 100/203 (49%)
Tbx6NP_035668.2 TBOX 90..277 CDD:238106 100/204 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.