DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H15 and tbx-42

DIOPT Version :9

Sequence 1:NP_608926.2 Gene:H15 / 33769 FlyBaseID:FBgn0016660 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_500749.1 Gene:tbx-42 / 190421 WormBaseID:WBGene00022000 Length:308 Species:Caenorhabditis elegans


Alignment Length:197 Identity:44/197 - (22%)
Similarity:85/197 - (43%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 TPVQCHLETKELWDKFHELGTEMIITKSGRR---MFPTVRVSFSGPLRQIQPADRYAVLLDVVPL 336
            |.:...:..:|||.:.:. ..|||  .:.:|   :||.::...||    ::...||.::|.:..:
 Worm     5 TQIVVKMSNEELWKERYP-NMEMI--SNSKRITPIFPEIKFKISG----LEENSRYVLVLSLEKM 62

  Fly   337 DSRRYRYAYHRSSWLVAGKADPPP--PSRIYAHPDCPLSPEALRKQVVSFEKVKLTNNE--MDKS 397
            |:.||....:: .|..:....|.|  ..:.:.||:.....:.|..:.|.|..|::|.:|  .:|.
 Worm    63 DNIRYGINENK-EWAPSSARKPKPHHNMKFFFHPEGTKLGKELMAETVEFTSVRITTSEKLSEKE 126

  Fly   398 GQVVLNSMHRYQPRIHLVRLSHGQSIPGSPKELQDMDHKTFVFPETVFTAVTAYQNQLITKLKID 462
            ....:::||:|.|.:.:..|:.|           ::....|......|..|:.||...:.:.|.|
 Worm   127 NVFYVHTMHKYVPVLTIRNLTTG-----------EIASNIFKMEIAQFFPVSIYQQASMGRWKSD 180

  Fly   463 SN 464
            .|
 Worm   181 LN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H15NP_608926.2 TBOX 276..475 CDD:238106 43/196 (22%)
tbx-42NP_500749.1 T-box 9..190 CDD:279278 43/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.